PREDICTED: Stomoxys calcitrans uncharacterized LOC131996891

LOCUS       XM_059367075             601 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996891), mRNA.
ACCESSION   XM_059367075
VERSION     XM_059367075.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 14% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..601
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..601
                     /gene="LOC131996891"
                     /note="uncharacterized LOC131996891; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996891"
     CDS             1..549
                     /gene="LOC131996891"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996891"
                     /protein_id="XP_059223058.1"
                     /db_xref="GeneID:131996891"
                     /translation="MVMQQMEGHNLLRQLTKGLHLHGTPNELPTSTAALHLYAASMAA
                     KAASNCIQIGPWAPFLHLNPGVMGGNPFSLLEQSCPVSSLSSQAADIPSLVASQPVGA
                     QIYPPIIPEKPRIAVRRHTDMLASDQLNYLHETAKELSPTATASVIAPVQLKMKLPIQ
                     LMQPLPPNFQTPVGKEPNDEAS"
ORIGIN      
        1 atggtcatgc agcaaatgga ggggcataat ctgctgaggc aattgaccaa gggcttacat
       61 ttgcatggga cgccaaatga attaccaaca tcgacggcgg ctttacattt atatgccgcc
      121 tcaatggcag ccaaggctgc ctccaattgc atacaaattg gcccttgggc tccatttttg
      181 catttgaatc ccggtgtgat gggcggtaat cctttttccc tgctagaaca atcatgccct
      241 gtctccagtt tgtcgtctca agcagcggat ataccttcac tagtagccag ccaacctgtg
      301 ggagcccaaa tatatcctcc cattatacct gaaaaacctc gtattgcagt ccgccggcat
      361 acggatatgt tggcttctga tcaactgaac tacctgcatg aaactgcaaa ggagttatca
      421 ccaacagcta ctgcttcagt cattgcacca gttcaactta aaatgaaact acccatacaa
      481 ctaatgcaac ctctacctcc aaattttcag acacccgtcg gcaaggaacc caatgatgaa
      541 gcctcataaa taaacactga agcatgtaaa agggctaaag caaggcaggt ttatcattaa
      601 c