PREDICTED: Stomoxys calcitrans uncharacterized LOC131996890

LOCUS       XM_059367074             381 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996890), mRNA.
ACCESSION   XM_059367074
VERSION     XM_059367074.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..381
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..381
                     /gene="LOC131996890"
                     /note="uncharacterized LOC131996890; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996890"
     CDS             1..381
                     /gene="LOC131996890"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996890"
                     /protein_id="XP_059223057.1"
                     /db_xref="GeneID:131996890"
                     /translation="MLSQFSKNPRKQHLNAAFQVLKYLSTTSNAVITYKKTSKPIIGF
                     CDASWAQDVNNRKSQSGFCFVLANSVVSWESKKQKVVATSSAEAEYIALTESAKEASY
                     LNYILEELGFSKEEPIFSKCTTNG"
ORIGIN      
        1 atgttatcac aattttccaa aaatccacgg aagcaacatt taaacgctgc ttttcaagta
       61 ctaaaatatc tcagtaccac aagcaacgca gttataacgt acaaaaagac ctcaaaacct
      121 attatcggat tttgtgatgc cagttgggct caagacgtga ataatcgaaa atctcaatct
      181 ggattttgtt ttgtgttggc aaatagtgta gtatcctggg aatctaaaaa acaaaaagtt
      241 gttgcgactt ctagtgctga agcagagtat attgctctaa cagaatccgc aaaagaagca
      301 tcatatttaa actatatcct tgaagaacta ggattttcaa aagaagaacc gatcttctca
      361 aagtgcacaa caaatggcta a