Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans aspartic and glutamic acid-rich


LOCUS       XM_059367057             813 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC131996878), mRNA.
ACCESSION   XM_059367057
VERSION     XM_059367057.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..813
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..813
                     /gene="LOC131996878"
                     /note="aspartic and glutamic acid-rich protein-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:131996878"
     CDS             1..813
                     /gene="LOC131996878"
                     /codon_start=1
                     /product="aspartic and glutamic acid-rich protein-like"
                     /protein_id="XP_059223040.1"
                     /db_xref="GeneID:131996878"
                     /translation="MVITLVFSIVFSLAFPLVYPILVFPVVFPVVFPVVFPVGFPVGF
                     PVGFPVGFPVGFPVGFPVGFLVVFPLVYALGIPKRIPKGNQKANQRKVRREDQGEDQS
                     KYQGEVQKEDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQSKDQSEDQSEDQSEDQSED
                     QSEDQSEDQREDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQSEDQS
                     EDQSKDQSEDQSEDQREDHKKDQRKVQSLDPQKGKPMGRSKEGPKRKPKGSQ"
ORIGIN      
        1 atggtcatca ccttggtctt ctccatagtc ttctccttgg ccttcccttt ggtctatccg
       61 attttggtgt tccctgtggt cttccctgtg gtcttccctg tagtcttccc tgtgggcttc
      121 cctgtgggct tccctgtggg cttccctgtg ggcttccctg tgggcttccc tgtgggcttc
      181 cctgtgggct tccttgtggt cttcccattg gtctacgctt tgggaatccc gaagagaatt
      241 ccaaagggaa accagaaggc aaaccaaagg aaagttcgaa gagaagacca aggcgaagac
      301 caaagcaaat atcaaggcga agttcaaaaa gaagatcaaa gcgaagacca aagcgaagac
      361 caaagcgaag accaaagcga agaccaaagc gaagaccaaa gcgaagacca aagcgaagac
      421 caaagcaaag accaaagcga agaccaaagc gaagaccaaa gcgaagacca aagcgaagac
      481 caaagcgaag accaaagcga agaccagaga gaagaccaaa gcgaagacca aagcgaagac
      541 caaagcgaag accaaagcga agaccaaagc gaagaccaaa gcgaagacca aagcgaagac
      601 caaagcgaag accaaagtga agaccaaagc gaagaccaaa gcgaagacca aagcgaagac
      661 caaagcaaag accaaagcga agaccaaagc gaagaccaga gagaagacca taagaaagat
      721 caaagaaaag tccagagctt agacccacaa aagggtaaac caatgggaag gtcaaaagaa
      781 ggacctaaga gaaaaccaaa gggaagccaa tag