PREDICTED: Stomoxys calcitrans proline-rich protein 2-like

LOCUS       XM_059367056             588 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996876), mRNA.
ACCESSION   XM_059367056
VERSION     XM_059367056.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..588
                     /gene="LOC131996876"
                     /note="proline-rich protein 2-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:131996876"
     CDS             1..588
                     /gene="LOC131996876"
                     /codon_start=1
                     /product="proline-rich protein 2-like"
                     /protein_id="XP_059223039.1"
                     /db_xref="GeneID:131996876"
                     /translation="MATLCTGMPLLLLRQRLAKYYKHASTANDSDDDAGKEDFTTISV
                     SAAGIYLSIRTAPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPP
                     QGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGRPPQGR
                     PPQGRPPQGRPPQGRPPQGRPPLWRVSPPLDIKKL"
ORIGIN      
        1 atggctacgc tgtgcacagg gatgccgctg ctgctgctgc gtcaacgttt agctaaatat
       61 tacaagcatg cgtcaaccgc caacgacagc gatgatgacg ccggtaaaga agacttcaca
      121 acgattagcg tcagcgctgc tggcatctat ctatctatca ggacggcccc acagggacgg
      181 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      241 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      301 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      361 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      421 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      481 cccccacagg gacggccccc acagggacgg cccccacagg gacggccccc acagggacgg
      541 cccccccttt ggagggtttc cccccctttg gatatcaaaa aattataa