PREDICTED: Stomoxys calcitrans nuclear factor NF-kappa-B p110

LOCUS       XM_059367055             765 bp    mRNA    linear   INV 02-SEP-2023
            subunit-like (LOC106087889), mRNA.
ACCESSION   XM_059367055
VERSION     XM_059367055.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..765
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..765
                     /gene="LOC106087889"
                     /note="nuclear factor NF-kappa-B p110 subunit-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:106087889"
     CDS             1..765
                     /gene="LOC106087889"
                     /codon_start=1
                     /product="nuclear factor NF-kappa-B p110 subunit-like"
                     /protein_id="XP_059223038.1"
                     /db_xref="GeneID:106087889"
                     /translation="MEKHKRVLRPYKTMYEIINMYLNQSSPDYHEALAENPRQFSAYL
                     NDPTHHDNIILSENSLRQNLLHTCCKYNRYQAIIPLIRLGCNPAKQDYDGRTPLHLAI
                     QLKAGKCIQQFLQLLRQESNPELIENLKGMFKPYNNIGQTIVHQAVLQRKIHIVKELL
                     QFCNRNNINVLEMEVLGSGKSLLHLAVDNQDYEMQTVIVMSVPKSIHVANYAGSLPFE
                     EREDLQRILSDVEKMKSDKALTDISQEVDDIEQKAT"
ORIGIN      
        1 atggaaaagc ataaacgtgt gctaagacca tacaaaacca tgtatgagat aattaatatg
       61 tacttaaatc aatcatcgcc tgattatcat gaagctctag ctgaaaaccc tcgacaattt
      121 tctgcttatc taaatgaccc aacacaccac gacaacatta ttttaagtga aaatagtctt
      181 cgacaaaatc ttctacatac ttgttgcaaa tataacagat atcaagctat catacccctt
      241 attcgactgg gttgcaatcc agccaaacag gactatgatg gacgtacacc tcttcatttg
      301 gccatacaat taaaagctgg caagtgcata caacaatttt tacaactgct gcgacaggag
      361 agcaatccag agctaataga aaatcttaaa ggaatgttta aaccctacaa taacatagga
      421 caaactattg tgcatcaggc tgtgttgcaa cgtaaaatac acatcgtaaa agagctctta
      481 caattttgca atagaaacaa tataaacgtt ttggaaatgg aggtattggg tagtggaaaa
      541 tctctgctac atttggctgt tgacaatcag gactatgaaa tgcaaacggt aattgtcatg
      601 tcagtgccga aaagtataca tgtggcaaat tatgctgggt cattgccttt tgaagaaaga
      661 gaagatttgc aaagaattct gagcgatgtg gagaaaatga aaagtgataa agctttaacc
      721 gatatctctc aagaagtaga tgatattgag cagaaagcta cataa