Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996870


LOCUS       XM_059367043             750 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996870), mRNA.
ACCESSION   XM_059367043
VERSION     XM_059367043.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..750
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..750
                     /gene="LOC131996870"
                     /note="uncharacterized LOC131996870; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996870"
     CDS             161..394
                     /gene="LOC131996870"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996870"
                     /protein_id="XP_059223026.1"
                     /db_xref="GeneID:131996870"
                     /translation="MNSNKVFGLLIISVLLVSALEPTPSSAAKVIFYGPPKVLHSQLL
                     TMVSRKAPCPKGKIRDHRNICRKALTFSRLAPR"
ORIGIN      
        1 ctaatcaatc gatatttgaa ggtggcggag tacacattga aataaaataa tcaaaaaggt
       61 gcggaatttc attcaatact attgtgcaga caaaaatttc tacgttccgt ataattaaat
      121 gttaaaatat taaagtcgtt aaggaaaaaa catattagag atgaatagca ataaagtgtt
      181 tggcctgtta ataatctccg tactcttggt tagtgcattg gagcccactc caagttcggc
      241 ggcaaaagta atattttatg gacccccgaa agtgttgcac tctcagctct tgacaatggt
      301 gtcgcggaaa gcgccctgtc ccaagggcaa aataagggat catcgtaata tttgtaggaa
      361 agctctcaca tttagtagat tggcacctag ataagactaa agttggaacg agtaactgct
      421 acgagggtat tacaaacgtc ccaaagtatt gaattgaata ctatatgcaa aaaaataatt
      481 taaggctata taaactttgg caacaaaaaa aaaattagct ttgccaaggg tttatgaatc
      541 tccgtttgag aacctttatg aaagaaacat ccttgtgaca ttttttaaag tttcaaccat
      601 agttttaatg aaattttgta caaaatgcat atatttttta tagtttttat atatttattt
      661 atttattacc ataacatacc aaaataactc gaacgacaat gtcatctaaa aaccaaaaat
      721 taacaaacga actttgagcc aatgttgcct