Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367043 750 bp mRNA linear INV 02-SEP-2023 (LOC131996870), mRNA. ACCESSION XM_059367043 VERSION XM_059367043.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..750 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..750 /gene="LOC131996870" /note="uncharacterized LOC131996870; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996870" CDS 161..394 /gene="LOC131996870" /codon_start=1 /product="uncharacterized protein LOC131996870" /protein_id="XP_059223026.1" /db_xref="GeneID:131996870" /translation="MNSNKVFGLLIISVLLVSALEPTPSSAAKVIFYGPPKVLHSQLL TMVSRKAPCPKGKIRDHRNICRKALTFSRLAPR" ORIGIN 1 ctaatcaatc gatatttgaa ggtggcggag tacacattga aataaaataa tcaaaaaggt 61 gcggaatttc attcaatact attgtgcaga caaaaatttc tacgttccgt ataattaaat 121 gttaaaatat taaagtcgtt aaggaaaaaa catattagag atgaatagca ataaagtgtt 181 tggcctgtta ataatctccg tactcttggt tagtgcattg gagcccactc caagttcggc 241 ggcaaaagta atattttatg gacccccgaa agtgttgcac tctcagctct tgacaatggt 301 gtcgcggaaa gcgccctgtc ccaagggcaa aataagggat catcgtaata tttgtaggaa 361 agctctcaca tttagtagat tggcacctag ataagactaa agttggaacg agtaactgct 421 acgagggtat tacaaacgtc ccaaagtatt gaattgaata ctatatgcaa aaaaataatt 481 taaggctata taaactttgg caacaaaaaa aaaattagct ttgccaaggg tttatgaatc 541 tccgtttgag aacctttatg aaagaaacat ccttgtgaca ttttttaaag tttcaaccat 601 agttttaatg aaattttgta caaaatgcat atatttttta tagtttttat atatttattt 661 atttattacc ataacatacc aaaataactc gaacgacaat gtcatctaaa aaccaaaaat 721 taacaaacga actttgagcc aatgttgcct