Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996862


LOCUS       XM_059367021             476 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996862), mRNA.
ACCESSION   XM_059367021
VERSION     XM_059367021.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..476
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..476
                     /gene="LOC131996862"
                     /note="uncharacterized LOC131996862; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996862"
     CDS             17..475
                     /gene="LOC131996862"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996862"
                     /protein_id="XP_059223004.1"
                     /db_xref="GeneID:131996862"
                     /translation="MRSLKNLFAITIVVFCCFTYSFAIRCLICDNEESCKKPAKLECN
                     ATMANTARFYLDYHHTGVNTTLTSQYLDCFSERIESYEGKFAFKGCMYNNINACELPL
                     RQMHAPGATKQSCNKCNNRDYCNPANRATTNVFAIAATVIMGIASRRIWA"
ORIGIN      
        1 caagtacctt ttaaaaatga gatctttaaa aaatctattt gccattacaa tagtggtatt
       61 ttgctgcttc acatacagct ttgctattag atgtctaatc tgcgacaatg aagaatcctg
      121 taagaagcct gcaaaattag aatgtaatgc cacaatggcc aataccgcac gattctattt
      181 ggattaccat cacacggggg tcaatacaac attaacaagt caatatttgg actgttttag
      241 tgagaggatt gaaagttatg agggcaaatt tgcttttaaa ggctgcatgt acaacaatat
      301 aaacgcttgc gaattaccat tgcgtcaaat gcatgctcct ggagccacta aacaatcgtg
      361 caataagtgc aataaccggg attattgcaa tccagctaat cgcgccacta caaatgtctt
      421 cgctattgcc gccacagtta tcatgggcat tgcttcacgt cgcatttggg cttaag