Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367021 476 bp mRNA linear INV 02-SEP-2023 (LOC131996862), mRNA. ACCESSION XM_059367021 VERSION XM_059367021.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..476 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..476 /gene="LOC131996862" /note="uncharacterized LOC131996862; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996862" CDS 17..475 /gene="LOC131996862" /codon_start=1 /product="uncharacterized protein LOC131996862" /protein_id="XP_059223004.1" /db_xref="GeneID:131996862" /translation="MRSLKNLFAITIVVFCCFTYSFAIRCLICDNEESCKKPAKLECN ATMANTARFYLDYHHTGVNTTLTSQYLDCFSERIESYEGKFAFKGCMYNNINACELPL RQMHAPGATKQSCNKCNNRDYCNPANRATTNVFAIAATVIMGIASRRIWA" ORIGIN 1 caagtacctt ttaaaaatga gatctttaaa aaatctattt gccattacaa tagtggtatt 61 ttgctgcttc acatacagct ttgctattag atgtctaatc tgcgacaatg aagaatcctg 121 taagaagcct gcaaaattag aatgtaatgc cacaatggcc aataccgcac gattctattt 181 ggattaccat cacacggggg tcaatacaac attaacaagt caatatttgg actgttttag 241 tgagaggatt gaaagttatg agggcaaatt tgcttttaaa ggctgcatgt acaacaatat 301 aaacgcttgc gaattaccat tgcgtcaaat gcatgctcct ggagccacta aacaatcgtg 361 caataagtgc aataaccggg attattgcaa tccagctaat cgcgccacta caaatgtctt 421 cgctattgcc gccacagtta tcatgggcat tgcttcacgt cgcatttggg cttaag