Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106086218


LOCUS       XM_059367018            1088 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086218), transcript variant X2, mRNA.
ACCESSION   XM_059367018
VERSION     XM_059367018.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1088
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1088
                     /gene="LOC106086218"
                     /note="uncharacterized LOC106086218; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106086218"
     CDS             556..1026
                     /gene="LOC106086218"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086218 isoform X2"
                     /protein_id="XP_059223001.1"
                     /db_xref="GeneID:106086218"
                     /translation="MDSYSSDTDLVLFYELNATRASRGVYACAGTMFLNYDVVEGDSN
                     EIEVKTYRSDSINGDYKPIPFSIQRQHIFEFMNNFYKNALMETLKDCSNLPVFKGDFV
                     PPLEKRNYTLDNCVFTQEGFPHHIQDGYYKIAFNAFGDVEWSMIFYAIVENILR"
     polyA_site      1088
                     /gene="LOC106086218"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agttgttgtt gtatcagtgt gttgtgttct atcgtctgtc tgcttggctc gattgagtat
       61 tcaggtccag gaactctgcg acgaggatgg aaatttgcac gtcggcagca tctaccgaat
      121 cgtaattgag ctagaactac tctggtttgc cggaggaggt caattacttc aggtgaaatg
      181 tgaggcggtc gctctacatg gaccactttc acccgcttct gggcggtgga tacctatcca
      241 caagatgatg atctggatgg tctctgcgat agcagcccag aaggtaatgc ttagacagca
      301 tgggtaggat ctgtgcctcc tgatggtggt ggtccacata agaactgagg agacagcccg
      361 tcgtagcttg gagagcggca ttctgacaga tcttaataat attccactgc gtggcagagc
      421 tgacgacacc acactaacgc tgcataactt accacagatc ggctaattgc tttgtacgtg
      481 gtcaacaatg tttctttgtt agcacctaaa gtgcttccgg caagtgagca tacttgggaa
      541 tacgagctga tctcaatgga tagttattcc tctgataccg acttagtgct gttctatgaa
      601 ctgaatgcga ctagagccag tcgtggagtt tacgcttgcg caggaacgat gtttctcaat
      661 tatgacgtag tagaaggtga ctccaatgag atagaagtaa aaacgtaccg aagtgacagc
      721 ataaacgggg attataagcc catacccttc tctatacaga ggcagcatat ttttgagttt
      781 atgaacaatt tctataagaa tgcattgatg gaaacactaa aggattgttc gaatttgccg
      841 gtattcaagg gggattttgt gccaccttta gagaagagaa attacacatt ggacaattgt
      901 gtttttaccc aagagggatt tccccaccat atacaggatg gttactacaa gatcgccttt
      961 aatgccttcg gcgatgttga gtggtcaatg attttttatg ccatagttga gaacatttta
     1021 cgatagatac aaattgcgca cagattgatt tttatgattt ttaaaaaata aattctcagt
     1081 gcaaacaa