Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367018 1088 bp mRNA linear INV 02-SEP-2023 (LOC106086218), transcript variant X2, mRNA. ACCESSION XM_059367018 VERSION XM_059367018.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1088 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1088 /gene="LOC106086218" /note="uncharacterized LOC106086218; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106086218" CDS 556..1026 /gene="LOC106086218" /codon_start=1 /product="uncharacterized protein LOC106086218 isoform X2" /protein_id="XP_059223001.1" /db_xref="GeneID:106086218" /translation="MDSYSSDTDLVLFYELNATRASRGVYACAGTMFLNYDVVEGDSN EIEVKTYRSDSINGDYKPIPFSIQRQHIFEFMNNFYKNALMETLKDCSNLPVFKGDFV PPLEKRNYTLDNCVFTQEGFPHHIQDGYYKIAFNAFGDVEWSMIFYAIVENILR" polyA_site 1088 /gene="LOC106086218" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agttgttgtt gtatcagtgt gttgtgttct atcgtctgtc tgcttggctc gattgagtat 61 tcaggtccag gaactctgcg acgaggatgg aaatttgcac gtcggcagca tctaccgaat 121 cgtaattgag ctagaactac tctggtttgc cggaggaggt caattacttc aggtgaaatg 181 tgaggcggtc gctctacatg gaccactttc acccgcttct gggcggtgga tacctatcca 241 caagatgatg atctggatgg tctctgcgat agcagcccag aaggtaatgc ttagacagca 301 tgggtaggat ctgtgcctcc tgatggtggt ggtccacata agaactgagg agacagcccg 361 tcgtagcttg gagagcggca ttctgacaga tcttaataat attccactgc gtggcagagc 421 tgacgacacc acactaacgc tgcataactt accacagatc ggctaattgc tttgtacgtg 481 gtcaacaatg tttctttgtt agcacctaaa gtgcttccgg caagtgagca tacttgggaa 541 tacgagctga tctcaatgga tagttattcc tctgataccg acttagtgct gttctatgaa 601 ctgaatgcga ctagagccag tcgtggagtt tacgcttgcg caggaacgat gtttctcaat 661 tatgacgtag tagaaggtga ctccaatgag atagaagtaa aaacgtaccg aagtgacagc 721 ataaacgggg attataagcc catacccttc tctatacaga ggcagcatat ttttgagttt 781 atgaacaatt tctataagaa tgcattgatg gaaacactaa aggattgttc gaatttgccg 841 gtattcaagg gggattttgt gccaccttta gagaagagaa attacacatt ggacaattgt 901 gtttttaccc aagagggatt tccccaccat atacaggatg gttactacaa gatcgccttt 961 aatgccttcg gcgatgttga gtggtcaatg attttttatg ccatagttga gaacatttta 1021 cgatagatac aaattgcgca cagattgatt tttatgattt ttaaaaaata aattctcagt 1081 gcaaacaa