Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367017 928 bp mRNA linear INV 02-SEP-2023 (LOC106094385), mRNA. ACCESSION XM_059367017 VERSION XM_059367017.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..928 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..928 /gene="LOC106094385" /note="uncharacterized LOC106094385; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106094385" CDS 102..902 /gene="LOC106094385" /codon_start=1 /product="uncharacterized protein LOC106094385" /protein_id="XP_059223000.1" /db_xref="GeneID:106094385" /translation="MMELAHKVSTECHSWTHDESMTHDSIKLHSVKYCSLYPKNELDC SMTKFENCKTNIYTKYDYYLEKYVHEIILLLDDLFKGHHKLTEKEILYQNTLIDDIWV NSQKHLMVTESSNCVKIYPEIVSLPAKKRFLTKIRSNILKIHASNCYMATSLQVISKT IDELKRRCDSLDYSVESPFLSGTYYLRPLSYFLNLINDLYLYFHEHLCKLQRWAELLD PADRLAIEDYCALIKPNKDYQNNLLEYVDHCCCWRSKRKRCIEEHVPC" polyA_site 928 /gene="LOC106094385" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taaacgtatg tacatacata ccaagatcca acataaataa aaaaggggtg ggattatata 61 tattaaaaaa ttcaaatttt agtaatattt ctggtcctta catgatggaa ttggcgcata 121 aagtttcaac tgaatgtcat agttggacac acgacgaaag catgactcat gattctatca 181 agctgcacag tgtcaaatat tgttcgttgt atccgaaaaa cgagttggat tgcagcatga 241 caaaatttga aaattgtaaa acaaacatat acaccaaata tgattattac ctggagaaat 301 atgtgcacga gattattttg ttactggatg atctatttaa aggccatcat aaattgacgg 361 aaaaggaaat cttgtatcag aacacgttaa ttgatgatat ttgggtgaat tctcaaaaac 421 atttgatggt gacggaaagc agtaattgcg ttaaaatcta tcctgagata gtatcattgc 481 cagccaagaa aagattttta accaaaatac gttcaaatat tttgaaaatc cacgcatcca 541 actgctatat ggccacatca ctacaagtaa ttagtaaaac tattgatgaa ttgaaacgtc 601 gttgtgatag cctggattat tcagtcgaaa gcccatttct ttcaggcact tattatttga 661 gaccacttag ctatttttta aacttgataa atgacctata cctatatttc catgaacatc 721 tgtgtaaact acaacgctgg gctgaacttt tagatcccgc agataggttg gctattgagg 781 attattgtgc attaataaaa ccgaataagg attaccaaaa taacctactg gagtatgtag 841 atcactgttg ctgctggcga tctaaacgaa aaagatgtat cgaagaacat gtgccttgtt 901 gatagtaaaa aaaaactaag ttgtttaa