Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans N-glycosylase/DNA lyase


LOCUS       XM_059366985            1176 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082626), transcript variant X2, mRNA.
ACCESSION   XM_059366985
VERSION     XM_059366985.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1176
                     /gene="LOC106082626"
                     /note="N-glycosylase/DNA lyase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106082626"
     CDS             71..1060
                     /gene="LOC106082626"
                     /codon_start=1
                     /product="N-glycosylase/DNA lyase isoform X1"
                     /protein_id="XP_059222968.1"
                     /db_xref="GeneID:106082626"
                     /translation="MLELQGSIAVNENELNLDLTLLGGQSFRWEKLQITDNENLWKGV
                     ACNAYWELKQDTKNLHYKVYSEPLSTKHDNVFYENLLKRYFRLDFNLNKNVTQWRKSH
                     PHFHEISGNLKAVRVLDQEPLENILSFICSQNNNIKRISTMINWLCSNYGNKIGNFHS
                     KDEYSFPTLESLIKHQNELESRLRSAKFGYRAKFIAQSVMKINEFGGYDWFEKLRTLP
                     YNEARIELAKVPGIGFKVADCICLMSLNHLESVPIDTHIFKIAQSVYMPQLRAVKAVT
                     PKIYEEIAEKFRQIYGAYAGWTQAVLFCSELRQFQTDQQTEKSPTKPKKKRNK"
ORIGIN      
        1 cgcaatcttt tcaaaagcgt ccgtttttca acatctaaaa attagttttc gttttgtatg
       61 ttaaaataaa atgttagaat tacaaggcag tattgcagtt aacgaaaatg aattaaattt
      121 agacttaaca ttattaggag gtcaaagttt tagatgggaa aagttgcaga ttacagataa
      181 tgaaaacttg tggaaaggtg tcgcctgtaa tgcctattgg gagctgaagc aagatacgaa
      241 gaatttgcat tacaaggttt attcggaacc attgagcacc aaacatgaca acgtgtttta
      301 tgagaatttg ttaaaacggt attttcgact ggatttcaac ttgaacaaaa acgtgacaca
      361 gtggcgtaag tcgcacccac attttcatga aatttcgggc aatttaaaag cagtacgtgt
      421 attggatcaa gaaccattgg aaaatattct ctcatttata tgcagtcaaa acaacaacat
      481 caaaagaatt tcaacaatga taaactggct ttgctcaaat tatggcaata aaatcggcaa
      541 cttccattca aaagatgaat actcatttcc tacactggaa tccttaatca aacaccaaaa
      601 tgagctggaa tcgagattac gttctgccaa atttggatac cgtgccaaat ttatagctca
      661 atctgtaatg aaaattaatg aatttggtgg ttatgattgg tttgaaaaac tgcgaacgct
      721 tccctataat gaagcccgca tcgaacttgc aaaggtacct ggcataggtt ttaaagtagc
      781 cgattgtatt tgtctaatgt ctttgaatca cttggaatca gtgcccattg atacacacat
      841 ttttaaaata gctcagagtg tgtatatgcc acaacttcgt gcagttaaag cagtcacacc
      901 aaaaatttac gaagagatag ccgaaaaatt tcgtcagata tatggagcgt acgcgggctg
      961 gactcaggcg gttctatttt gctccgaact acgacaattt caaaccgatc aacaaactga
     1021 aaaatcacca acgaaaccca aaaagaaacg taacaaatga aaggaaatta tcaacacgta
     1081 agtttatata tattttttta attacgttta attgttaaac agcgtaatat tcgtcattct
     1141 tacttttact taaatatttt gttaacattc gtttac