Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366984 1156 bp mRNA linear INV 02-SEP-2023 (LOC106082626), transcript variant X1, mRNA. ACCESSION XM_059366984 VERSION XM_059366984.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1156 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1156 /gene="LOC106082626" /note="N-glycosylase/DNA lyase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106082626" CDS 71..1060 /gene="LOC106082626" /codon_start=1 /product="N-glycosylase/DNA lyase isoform X1" /protein_id="XP_059222967.1" /db_xref="GeneID:106082626" /translation="MLELQGSIAVNENELNLDLTLLGGQSFRWEKLQITDNENLWKGV ACNAYWELKQDTKNLHYKVYSEPLSTKHDNVFYENLLKRYFRLDFNLNKNVTQWRKSH PHFHEISGNLKAVRVLDQEPLENILSFICSQNNNIKRISTMINWLCSNYGNKIGNFHS KDEYSFPTLESLIKHQNELESRLRSAKFGYRAKFIAQSVMKINEFGGYDWFEKLRTLP YNEARIELAKVPGIGFKVADCICLMSLNHLESVPIDTHIFKIAQSVYMPQLRAVKAVT PKIYEEIAEKFRQIYGAYAGWTQAVLFCSELRQFQTDQQTEKSPTKPKKKRNK" ORIGIN 1 cgcaatcttt tcaaaagcgt ccgtttttca acatctaaaa attagttttc gttttgtatg 61 ttaaaataaa atgttagaat tacaaggcag tattgcagtt aacgaaaatg aattaaattt 121 agacttaaca ttattaggag gtcaaagttt tagatgggaa aagttgcaga ttacagataa 181 tgaaaacttg tggaaaggtg tcgcctgtaa tgcctattgg gagctgaagc aagatacgaa 241 gaatttgcat tacaaggttt attcggaacc attgagcacc aaacatgaca acgtgtttta 301 tgagaatttg ttaaaacggt attttcgact ggatttcaac ttgaacaaaa acgtgacaca 361 gtggcgtaag tcgcacccac attttcatga aatttcgggc aatttaaaag cagtacgtgt 421 attggatcaa gaaccattgg aaaatattct ctcatttata tgcagtcaaa acaacaacat 481 caaaagaatt tcaacaatga taaactggct ttgctcaaat tatggcaata aaatcggcaa 541 cttccattca aaagatgaat actcatttcc tacactggaa tccttaatca aacaccaaaa 601 tgagctggaa tcgagattac gttctgccaa atttggatac cgtgccaaat ttatagctca 661 atctgtaatg aaaattaatg aatttggtgg ttatgattgg tttgaaaaac tgcgaacgct 721 tccctataat gaagcccgca tcgaacttgc aaaggtacct ggcataggtt ttaaagtagc 781 cgattgtatt tgtctaatgt ctttgaatca cttggaatca gtgcccattg atacacacat 841 ttttaaaata gctcagagtg tgtatatgcc acaacttcgt gcagttaaag cagtcacacc 901 aaaaatttac gaagagatag ccgaaaaatt tcgtcagata tatggagcgt acgcgggctg 961 gactcaggcg gttctatttt gctccgaact acgacaattt caaaccgatc aacaaactga 1021 aaaatcacca acgaaaccca aaaagaaacg taacaaatga aaggaaatta tcaacacgtt 1081 tcattcgtaa agcctactta catgattcga caatacctac caattggaga ctcgaatgca 1141 attttatttt aaggtt