Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106093148


LOCUS       XM_059366974             665 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106093148), transcript variant X2, mRNA.
ACCESSION   XM_059366974
VERSION     XM_059366974.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..665
                     /gene="LOC106093148"
                     /note="uncharacterized LOC106093148; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106093148"
     CDS             75..479
                     /gene="LOC106093148"
                     /codon_start=1
                     /product="uncharacterized protein LOC106093148 isoform X2"
                     /protein_id="XP_059222957.1"
                     /db_xref="GeneID:106093148"
                     /translation="MADEEEEELGMTSEEIVDALESFGDNCDIKPERDHIKQLVKNEE
                     NPHQNAKCFRHCLMKEFELIAEGSTTMNEEKAVDMLGMMFSDSKDDLEEIVKICNGEN
                     AGVAEKCENAHKHGMCILRELKARNYKIPQPG"
     polyA_site      665
                     /gene="LOC106093148"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gccaatctca acaaaaaact tcggctgagc cgaaataatt aaacataaag gaatcagaat
       61 atttttctca ctttatggct gatgaggagg aggaagaatt aggtatgact tccgaagaaa
      121 tagttgatgc attggagtct tttggagata attgtgatat taaaccagaa agagatcata
      181 ttaaacagct ggtgaaaaat gaagagaatc cccatcaaaa tgcgaaatgt ttccggcatt
      241 gtttgatgaa agaatttgaa ttgatcgcag aaggctccac aacaatgaat gaagagaagg
      301 ctgttgatat gttgggtatg atgttttctg atagcaaaga tgacttggag gaaattgtta
      361 aaatatgcaa tggcgaaaat gctggggtag cagaaaaatg tgagaatgcc cacaaacatg
      421 gaatgtgtat attacgagag ctgaaggccc gcaactataa aattccacag cccggataat
      481 aatggagtac attgtagacc acttttccag cttacctgat aaagaccacg gatactgata
      541 acttgattaa agattgacca agaatatttt attacttttt taccaaatag ctttagatgt
      601 ttattgcaaa tattatcaca cggtgcaaag caaatatagc gttcatatcc ttatttttaa
      661 cgtaa