Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366974 665 bp mRNA linear INV 02-SEP-2023 (LOC106093148), transcript variant X2, mRNA. ACCESSION XM_059366974 VERSION XM_059366974.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..665 /gene="LOC106093148" /note="uncharacterized LOC106093148; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106093148" CDS 75..479 /gene="LOC106093148" /codon_start=1 /product="uncharacterized protein LOC106093148 isoform X2" /protein_id="XP_059222957.1" /db_xref="GeneID:106093148" /translation="MADEEEEELGMTSEEIVDALESFGDNCDIKPERDHIKQLVKNEE NPHQNAKCFRHCLMKEFELIAEGSTTMNEEKAVDMLGMMFSDSKDDLEEIVKICNGEN AGVAEKCENAHKHGMCILRELKARNYKIPQPG" polyA_site 665 /gene="LOC106093148" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gccaatctca acaaaaaact tcggctgagc cgaaataatt aaacataaag gaatcagaat 61 atttttctca ctttatggct gatgaggagg aggaagaatt aggtatgact tccgaagaaa 121 tagttgatgc attggagtct tttggagata attgtgatat taaaccagaa agagatcata 181 ttaaacagct ggtgaaaaat gaagagaatc cccatcaaaa tgcgaaatgt ttccggcatt 241 gtttgatgaa agaatttgaa ttgatcgcag aaggctccac aacaatgaat gaagagaagg 301 ctgttgatat gttgggtatg atgttttctg atagcaaaga tgacttggag gaaattgtta 361 aaatatgcaa tggcgaaaat gctggggtag cagaaaaatg tgagaatgcc cacaaacatg 421 gaatgtgtat attacgagag ctgaaggccc gcaactataa aattccacag cccggataat 481 aatggagtac attgtagacc acttttccag cttacctgat aaagaccacg gatactgata 541 acttgattaa agattgacca agaatatttt attacttttt taccaaatag ctttagatgt 601 ttattgcaaa tattatcaca cggtgcaaag caaatatagc gttcatatcc ttatttttaa 661 cgtaa