Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366854 604 bp mRNA linear INV 02-SEP-2023 (LOC131996825), mRNA. ACCESSION XM_059366854 VERSION XM_059366854.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..604 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..604 /gene="LOC131996825" /note="uncharacterized LOC131996825; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996825" CDS 80..496 /gene="LOC131996825" /codon_start=1 /product="uncharacterized protein LOC131996825" /protein_id="XP_059222837.1" /db_xref="GeneID:131996825" /translation="MHLAKYSILILLLLAIKLCSGNDQATDSPSSLDNNINSNLNHQK GRRKSCPPAEVPKPTPTEAPEPPPTGLRTLETINDCLALSDGTFLVDGRHCRRYYICQ KQRVERLRCSIDQWFDRDISKCMDRNLVTNCPSNRS" polyA_site 604 /gene="LOC131996825" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgttcgaag ttaagttgca atcgtttgct acagggaaca agtaaatctt ctaaggttct 61 tctttgatga gaggttgcaa tgcatcttgc taaatattca atactgattt tgttactact 121 tgctatcaaa ctatgtagtg gcaatgatca ggccactgat tccccgtcat cgcttgacaa 181 caatataaac agcaatctaa atcatcagaa gggaagacga aagtcatgtc cacctgctga 241 agtgccaaag ccaactccta cagaagcccc agagccacct ccaactggtt tacgaaccct 301 tgaaaccatt aacgattgtc tggctctatc tgatggtact ttcctcgttg acggccgcca 361 ttgtcgacgc tactatatct gccaaaaaca acgtgttgaa cgtcttcgtt gttccattga 421 tcaatggttc gaccgtgata tttcaaaatg tatggaccgc aatttggtaa ccaactgtcc 481 aagcaacagg tcctaattcc cctttatgac tcaccgtcat cgaattcccc aaacagtagg 541 tgatgtatta tattggcaag gatggtaaat acatgataaa aataaaaatt atctcaagca 601 agaa