Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996825


LOCUS       XM_059366854             604 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996825), mRNA.
ACCESSION   XM_059366854
VERSION     XM_059366854.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..604
                     /gene="LOC131996825"
                     /note="uncharacterized LOC131996825; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996825"
     CDS             80..496
                     /gene="LOC131996825"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996825"
                     /protein_id="XP_059222837.1"
                     /db_xref="GeneID:131996825"
                     /translation="MHLAKYSILILLLLAIKLCSGNDQATDSPSSLDNNINSNLNHQK
                     GRRKSCPPAEVPKPTPTEAPEPPPTGLRTLETINDCLALSDGTFLVDGRHCRRYYICQ
                     KQRVERLRCSIDQWFDRDISKCMDRNLVTNCPSNRS"
     polyA_site      604
                     /gene="LOC131996825"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgttcgaag ttaagttgca atcgtttgct acagggaaca agtaaatctt ctaaggttct
       61 tctttgatga gaggttgcaa tgcatcttgc taaatattca atactgattt tgttactact
      121 tgctatcaaa ctatgtagtg gcaatgatca ggccactgat tccccgtcat cgcttgacaa
      181 caatataaac agcaatctaa atcatcagaa gggaagacga aagtcatgtc cacctgctga
      241 agtgccaaag ccaactccta cagaagcccc agagccacct ccaactggtt tacgaaccct
      301 tgaaaccatt aacgattgtc tggctctatc tgatggtact ttcctcgttg acggccgcca
      361 ttgtcgacgc tactatatct gccaaaaaca acgtgttgaa cgtcttcgtt gttccattga
      421 tcaatggttc gaccgtgata tttcaaaatg tatggaccgc aatttggtaa ccaactgtcc
      481 aagcaacagg tcctaattcc cctttatgac tcaccgtcat cgaattcccc aaacagtagg
      541 tgatgtatta tattggcaag gatggtaaat acatgataaa aataaaaatt atctcaagca
      601 agaa