Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366843 605 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_059366843 VERSION XM_059366843.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..605 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..605 /gene="LOC106088948" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106088948" CDS 21..512 /gene="LOC106088948" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_059222826.1" /db_xref="GeneID:106088948" /translation="MWTLKTYSLRFVLLVTILNCVSAEPQLHAAADGTKFYIEIDGKY NWFQALHECARRGYQLVEVHTGQKHNVLMNALDSFFGKPHNLWLGANDEYNSERDFNR PFYWASSGKRMIFSYWSSNNPDNYRNNEHCVHTWTEREHFAWNDAPCTSKMGYVCEQK TVP" ORIGIN 1 ttcgattttg agttttgaaa atgtggacac ttaaaacgta ctcgctgcgc tttgttttat 61 tggtcacaat attgaattgt gtcagcgcag aaccgcaatt acatgcagcg gctgatggta 121 caaaatttta tattgaaatc gatggaaagt acaattggtt tcaagcttta cacgaatgcg 181 ctcgccgtgg ttatcagttg gttgaagtac ataccggcca aaagcataat gttctaatga 241 atgctttgga ttcattcttt ggaaagccac ataacctatg gctgggagcc aatgatgagt 301 ataatagtga gcgagacttt aatagaccct tttattgggc ctcttctgga aaacgcatga 361 tattctccta ttggtccagc aataatccag acaattatag aaataatgag cactgcgtgc 421 atacctggac agagagagaa cattttgctt ggaacgatgc accttgcacc tcgaaaatgg 481 gctatgtttg tgagcagaaa actgtgccat agtatgagta ttacatataa caatactaaa 541 tatttaaaat ccattcaaaa agttaaataa actgagtttt ttgaatttta ttttataaaa 601 atcaa