Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106088948),


LOCUS       XM_059366843             605 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_059366843
VERSION     XM_059366843.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..605
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..605
                     /gene="LOC106088948"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106088948"
     CDS             21..512
                     /gene="LOC106088948"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_059222826.1"
                     /db_xref="GeneID:106088948"
                     /translation="MWTLKTYSLRFVLLVTILNCVSAEPQLHAAADGTKFYIEIDGKY
                     NWFQALHECARRGYQLVEVHTGQKHNVLMNALDSFFGKPHNLWLGANDEYNSERDFNR
                     PFYWASSGKRMIFSYWSSNNPDNYRNNEHCVHTWTEREHFAWNDAPCTSKMGYVCEQK
                     TVP"
ORIGIN      
        1 ttcgattttg agttttgaaa atgtggacac ttaaaacgta ctcgctgcgc tttgttttat
       61 tggtcacaat attgaattgt gtcagcgcag aaccgcaatt acatgcagcg gctgatggta
      121 caaaatttta tattgaaatc gatggaaagt acaattggtt tcaagcttta cacgaatgcg
      181 ctcgccgtgg ttatcagttg gttgaagtac ataccggcca aaagcataat gttctaatga
      241 atgctttgga ttcattcttt ggaaagccac ataacctatg gctgggagcc aatgatgagt
      301 ataatagtga gcgagacttt aatagaccct tttattgggc ctcttctgga aaacgcatga
      361 tattctccta ttggtccagc aataatccag acaattatag aaataatgag cactgcgtgc
      421 atacctggac agagagagaa cattttgctt ggaacgatgc accttgcacc tcgaaaatgg
      481 gctatgtttg tgagcagaaa actgtgccat agtatgagta ttacatataa caatactaaa
      541 tatttaaaat ccattcaaaa agttaaataa actgagtttt ttgaatttta ttttataaaa
      601 atcaa