Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996820


LOCUS       XM_059366842             400 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996820), mRNA.
ACCESSION   XM_059366842
VERSION     XM_059366842.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..400
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..400
                     /gene="LOC131996820"
                     /note="uncharacterized LOC131996820; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996820"
     CDS             69..383
                     /gene="LOC131996820"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996820"
                     /protein_id="XP_059222825.1"
                     /db_xref="GeneID:131996820"
                     /translation="MRFLIAICLILCMVAVSWAAEARGVFRNTAYPGKCYMSSSLILS
                     KGEVAKNPNIPCGGIRCEEKGVAVLQTCPIASFAGYKQGDFVNTSKPYPACCKRQLIK
                     LN"
     polyA_site      400
                     /gene="LOC131996820"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtatttaaa tataacaaat cagtgtgaac aaaattactt caataattgc tttcattcga
       61 acaacaccat gagattctta atcgcaattt gtttaatttt gtgtatggtg gcggtttcat
      121 gggcagcaga agctagagga gtttttagga atactgctta tcccggcaag tgttatatga
      181 gttccagttt aatactttcc aaaggcgaag tggctaaaaa tcccaatata ccgtgtggtg
      241 gcataagatg tgaggagaag ggagtggcgg tgctacagac atgtcctatt gcgagtttcg
      301 ctggctacaa acaaggagat tttgtaaata cctctaaacc ttatcctgca tgttgtaaac
      361 gtcaactgat taaattgaat taaataaagt tttgattgaa