Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366842 400 bp mRNA linear INV 02-SEP-2023 (LOC131996820), mRNA. ACCESSION XM_059366842 VERSION XM_059366842.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..400 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..400 /gene="LOC131996820" /note="uncharacterized LOC131996820; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996820" CDS 69..383 /gene="LOC131996820" /codon_start=1 /product="uncharacterized protein LOC131996820" /protein_id="XP_059222825.1" /db_xref="GeneID:131996820" /translation="MRFLIAICLILCMVAVSWAAEARGVFRNTAYPGKCYMSSSLILS KGEVAKNPNIPCGGIRCEEKGVAVLQTCPIASFAGYKQGDFVNTSKPYPACCKRQLIK LN" polyA_site 400 /gene="LOC131996820" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtatttaaa tataacaaat cagtgtgaac aaaattactt caataattgc tttcattcga 61 acaacaccat gagattctta atcgcaattt gtttaatttt gtgtatggtg gcggtttcat 121 gggcagcaga agctagagga gtttttagga atactgctta tcccggcaag tgttatatga 181 gttccagttt aatactttcc aaaggcgaag tggctaaaaa tcccaatata ccgtgtggtg 241 gcataagatg tgaggagaag ggagtggcgg tgctacagac atgtcctatt gcgagtttcg 301 ctggctacaa acaaggagat tttgtaaata cctctaaacc ttatcctgca tgttgtaaac 361 gtcaactgat taaattgaat taaataaagt tttgattgaa