Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sugar transporter SWEET1


LOCUS       XM_059366817            1217 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082898), transcript variant X1, mRNA.
ACCESSION   XM_059366817
VERSION     XM_059366817.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1217
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1217
                     /gene="LOC106082898"
                     /note="sugar transporter SWEET1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106082898"
     CDS             229..972
                     /gene="LOC106082898"
                     /codon_start=1
                     /product="sugar transporter SWEET1"
                     /protein_id="XP_059222800.1"
                     /db_xref="GeneID:106082898"
                     /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD
                     AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK
                     IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS
                     TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS
                     ASPKEKDSPPYSKLQSDSPSKSKTNKKRD"
     polyA_site      1217
                     /gene="LOC106082898"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctagtgaact gtgaaagagt gtagtagtag tagtagtagt agtatcttta ttcatttcat
       61 tttaaaaaat aaatcgtact tcgaatatta gattatgaaa taagatatac ggctttgact
      121 tagtgtcgtc agccggtaaa tttaatacaa acatttgaga tttgcatcag caaaaaatac
      181 tctgtatacg acgagagcac aagcactgca acaacgacca gtaacaacat ggaagtattg
      241 ggtgatctat tggagccgta cagcgatgaa attgcaaaat ttgccgggtc cataacatgt
      301 ctgcaatttt tgtccggtgt ttttcttatg aacgatatac gcaaaaaggg cagcagtgat
      361 gcatatcccc cggatccgtt cattggtggt gttgttttaa caatcctcag tttaaaactt
      421 ggaacactaa tgggcgatga ggccatgatt aaagtcaatg tcattggttt tgccattaat
      481 gttgttttca tggttatctt ctattggtat gcatcgggac cgtttaaatc aaaaatctgg
      541 tcgaaaatcg gcattgcaag tacatttaca atggcctgtt tggcctattc caatttcgag
      601 gatcctgcca aaattgagtt ccgttttgga atgctgatta cagcaatact ggttatactt
      661 gtgggtatgc ctctacttag tcttggtgaa attatcgaga aaaagagtac cgaaggttta
      721 ccattcccac tgattttgtc tggtacaata gtggcagcag catgggcagc gtatggcata
      781 tcgataagga atgatgttgt tacgtatcaa aatctatttt tgcttctcct aagttcaata
      841 caactttcgc tgttcgccat atatccaaac aatcccagca gtgccagtcc aaaggaaaag
      901 gatagccctc catatagtaa attacaatca gatagtccat ccaagtcgaa aacaaataag
      961 aaacgcgatt aatggcacac acaaagcatc acgcgcgcaa attataaagg cttactcgct
     1021 tggctaagtg caaacccatt gactttcatt caggttagag aagcaactaa ctgaaaaagc
     1081 tcgtgacatg catgcagcag aataaaaagc tttaaacgca atacttatgg cacctacaca
     1141 tacatctaac atttgaaatc agctgtgcaa aactttttga caataattaa aatcttccaa
     1201 taacgtataa cgataaa