Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366817 1217 bp mRNA linear INV 02-SEP-2023 (LOC106082898), transcript variant X1, mRNA. ACCESSION XM_059366817 VERSION XM_059366817.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1217 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1217 /gene="LOC106082898" /note="sugar transporter SWEET1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106082898" CDS 229..972 /gene="LOC106082898" /codon_start=1 /product="sugar transporter SWEET1" /protein_id="XP_059222800.1" /db_xref="GeneID:106082898" /translation="MEVLGDLLEPYSDEIAKFAGSITCLQFLSGVFLMNDIRKKGSSD AYPPDPFIGGVVLTILSLKLGTLMGDEAMIKVNVIGFAINVVFMVIFYWYASGPFKSK IWSKIGIASTFTMACLAYSNFEDPAKIEFRFGMLITAILVILVGMPLLSLGEIIEKKS TEGLPFPLILSGTIVAAAWAAYGISIRNDVVTYQNLFLLLLSSIQLSLFAIYPNNPSS ASPKEKDSPPYSKLQSDSPSKSKTNKKRD" polyA_site 1217 /gene="LOC106082898" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctagtgaact gtgaaagagt gtagtagtag tagtagtagt agtatcttta ttcatttcat 61 tttaaaaaat aaatcgtact tcgaatatta gattatgaaa taagatatac ggctttgact 121 tagtgtcgtc agccggtaaa tttaatacaa acatttgaga tttgcatcag caaaaaatac 181 tctgtatacg acgagagcac aagcactgca acaacgacca gtaacaacat ggaagtattg 241 ggtgatctat tggagccgta cagcgatgaa attgcaaaat ttgccgggtc cataacatgt 301 ctgcaatttt tgtccggtgt ttttcttatg aacgatatac gcaaaaaggg cagcagtgat 361 gcatatcccc cggatccgtt cattggtggt gttgttttaa caatcctcag tttaaaactt 421 ggaacactaa tgggcgatga ggccatgatt aaagtcaatg tcattggttt tgccattaat 481 gttgttttca tggttatctt ctattggtat gcatcgggac cgtttaaatc aaaaatctgg 541 tcgaaaatcg gcattgcaag tacatttaca atggcctgtt tggcctattc caatttcgag 601 gatcctgcca aaattgagtt ccgttttgga atgctgatta cagcaatact ggttatactt 661 gtgggtatgc ctctacttag tcttggtgaa attatcgaga aaaagagtac cgaaggttta 721 ccattcccac tgattttgtc tggtacaata gtggcagcag catgggcagc gtatggcata 781 tcgataagga atgatgttgt tacgtatcaa aatctatttt tgcttctcct aagttcaata 841 caactttcgc tgttcgccat atatccaaac aatcccagca gtgccagtcc aaaggaaaag 901 gatagccctc catatagtaa attacaatca gatagtccat ccaagtcgaa aacaaataag 961 aaacgcgatt aatggcacac acaaagcatc acgcgcgcaa attataaagg cttactcgct 1021 tggctaagtg caaacccatt gactttcatt caggttagag aagcaactaa ctgaaaaagc 1081 tcgtgacatg catgcagcag aataaaaagc tttaaacgca atacttatgg cacctacaca 1141 tacatctaac atttgaaatc agctgtgcaa aactttttga caataattaa aatcttccaa 1201 taacgtataa cgataaa