Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366809 1177 bp mRNA linear INV 02-SEP-2023 (LOC106093250), transcript variant X2, mRNA. ACCESSION XM_059366809 VERSION XM_059366809.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1177 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1177 /gene="LOC106093250" /note="uncharacterized LOC106093250; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106093250" CDS 414..953 /gene="LOC106093250" /codon_start=1 /product="uncharacterized protein LOC106093250" /protein_id="XP_059222792.1" /db_xref="GeneID:106093250" /translation="MTSSRSDNTHYSSKSLRRNAARRMPWWWPSTSPSSSSSSPTMPA RYHKLLLIVFSICLLQFVACLEEDCIDFQGNSVNHGMLYVPGPGVCSLCVCYHSEPLW CKAIYCDPPYFCKNFRVGERCCEFECLDPPGEDNKYQERMRKRAEILAGNSTAAPSIS PLAVSTLMLTFLGNSLLNL" polyA_site 1177 /gene="LOC106093250" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taaaacctta gcacacgtct ggcacagacg tcagttgcaa ttgaaatttt aaccagataa 61 ctttagttag tctcgttata cgcagtacga gtttaaattg tatcctgaaa aagcaaatga 121 ataaaaagga tgaagtgaag tctagagaaa tataaaaaca agtcacatac caaagagcaa 181 ataaaatata ataccaataa aatacagtgc ttaaataaac gacaacaaaa ttaagcgttt 241 aatacaatct gcagagaagg aaccagaaag agcgaaaaac gaagaaaacc ccatgcaata 301 aaatccataa acaaaaaaag ttattgcaaa ataaaaattc aaaactgcct tcatattgcc 361 caagcaaata acaacatcaa taataacctg gaaagaaatc acaatcaatt gaaatgactt 421 cgtcacgttc agacaacaca cactactcat ccaagtctct gcgaagaaat gctgctcgac 481 gcatgccatg gtggtggcca tcaacatcgc catcatcgtc gtcgtcgtcg ccaacaatgc 541 ctgccaggta ccacaaactg ctgctgatag tcttcagcat ttgcctgctc caatttgttg 601 cgtgtctgga ggaagattgc attgattttc aaggtaattc cgttaaccat ggcatgttgt 661 atgtaccagg gccaggcgtt tgcagtctgt gtgtttgcta tcactcggag ccattgtggt 721 gtaaagcaat ttactgtgat ccaccatatt tctgcaaaaa cttccgagtt ggagaacggt 781 gctgtgagtt tgaatgtcta gatccgccgg gagaagataa caaatatcag gaacgcatgc 841 gtaaacgagc tgaaattttg gctggcaaca gtacggcagc accatctata tcacctttag 901 ccgtttcaac tttaatgcta acatttctgg gaaactcatt gttaaactta taacttgagc 961 caaataatta attaattatt ataatatata atattaataa taattctaaa acttattctt 1021 aattagataa atgcaagatt taaatgaaat ttatgtaaaa aaaaacaaaa acaatgaaaa 1081 actctagaat gaaaaatcca aaatctatat aaactcaaat caattaagcg aaacaattat 1141 ttaatgaaat tcattaataa aaaccaaaca ataccta