Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans high affinity copper uptake protein


LOCUS       XM_059366802            1175 bp    mRNA    linear   INV 02-SEP-2023
            1 (LOC106081969), transcript variant X5, mRNA.
ACCESSION   XM_059366802
VERSION     XM_059366802.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1175
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1175
                     /gene="LOC106081969"
                     /note="high affinity copper uptake protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:106081969"
     CDS             327..1022
                     /gene="LOC106081969"
                     /codon_start=1
                     /product="high affinity copper uptake protein 1 isoform
                     X3"
                     /protein_id="XP_059222785.1"
                     /db_xref="GeneID:106081969"
                     /translation="MDHSEHSMDHHAGHDHGHSMHDMHGDAHAGHGILSLTTTTTTTM
                     PPTVIPATHEHLHHAPAGQSDMGHMNHMNHMMNHMMSMSFHFGYEETILFEFWKIDSI
                     AGLIGSMAGIFILAVLYEGLKYYREFLFWKTYNLLEYRPVTGPQTNPEVGQIQPAPSN
                     PTPVQPTMFSLNHFIQTALHMVQVTVSFLLMLIFMTYNVWLCLAVVVGAAVGYFLFCW
                     KKSVIVDVTEHCH"
     polyA_site      1175
                     /gene="LOC106081969"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtatgttaac gttaaaaaag tgaaaatttt taaggaaaga gtttaattta atggagatca
       61 gagaagaaaa cttgaaataa gaattcaatg tatgaaagct tattaatatg ttctctagta
      121 ttattgaatt tgatgatttc taaagtccaa tattacgaat tccgttgaga ccaagaaaaa
      181 agtataagtg gttttagagt tgtgtcaagc caacgccata tcagagcttt gaccaccatc
      241 tcggctaacc tctggatatt gtaaaaaagc atatatccta taacgttggc atacctgtac
      301 aagttttaca tctttaacag ttcataatgg accattcgga gcattctatg gatcaccatg
      361 ccggacatga tcatggtcac agcatgcacg atatgcatgg ggacgctcat gccggtcacg
      421 ggattttatc actgaccact acaacaacaa caacaatgcc accaacagtg atacccgcca
      481 cacatgagca cttgcatcat gcaccagctg gacagagcga tatgggacac atgaaccata
      541 tgaatcacat gatgaatcat atgatgtcta tgtcgtttca ttttggctat gaagaaacaa
      601 tactatttga attttggaaa attgatagca tcgctggctt aataggttcc atggcaggca
      661 tattcatatt ggccgtttta tatgaaggtt taaaatatta tcgggaattt ttgttttgga
      721 aaacatacaa tttattggaa tatcgcccag ttacggggcc acaaactaat ccagaggtgg
      781 gacaaataca accagcgccc agcaatccaa caccggtgca gccaacaatg ttctcgctga
      841 atcactttat tcagactgct ttgcatatgg tacaggttac agtatccttc ctactcatgt
      901 tgatattcat gacctacaat gtgtggctgt gtttggccgt tgttgtggga gctgccgtcg
      961 gctatttcct tttctgctgg aagaaatccg taattgtgga tgtaactgaa cattgtcact
     1021 agcaaaagac ccattatgaa tgttgggaag ctgcttggcg accaaagcga ggaatgcagc
     1081 tggcgcgtga caacgcaact tcaatgcaac gtcagctact tataaacgat gacctacaat
     1141 agacaaacaa aacaaaacaa caaaacaaac aaaca