Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366801 1205 bp mRNA linear INV 02-SEP-2023 1 (LOC106081969), transcript variant X4, mRNA. ACCESSION XM_059366801 VERSION XM_059366801.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1205 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1205 /gene="LOC106081969" /note="high affinity copper uptake protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106081969" CDS 327..1052 /gene="LOC106081969" /codon_start=1 /product="high affinity copper uptake protein 1 isoform X2" /protein_id="XP_059222784.1" /db_xref="GeneID:106081969" /translation="MDHSEHSMDHHAGHDHGHSMHDMHGDAHAGHGILSLTTTTTTTM PPTVIPATHEHLHHAPAGQSDMGHMNHMNHMMNHMMSMSFHFGYEETILFEFWKIDSI AGLIGSMAGIFILAVLYEGLKYYREFLFWKTYNLLEYRPVTGPQTNPEVGQIQPAPSN PTPVQYVGEVIHKQPPTMFSLNHFIQTALHMVQVTVSFLLMLIFMTYNVWLCLAVVVG AAVGYFLFCWKKSVIVDVTEHCH" polyA_site 1205 /gene="LOC106081969" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtatgttaac gttaaaaaag tgaaaatttt taaggaaaga gtttaattta atggagatca 61 gagaagaaaa cttgaaataa gaattcaatg tatgaaagct tattaatatg ttctctagta 121 ttattgaatt tgatgatttc taaagtccaa tattacgaat tccgttgaga ccaagaaaaa 181 agtataagtg gttttagagt tgtgtcaagc caacgccata tcagagcttt gaccaccatc 241 tcggctaacc tctggatatt gtaaaaaagc atatatccta taacgttggc atacctgtac 301 aagttttaca tctttaacag ttcataatgg accattcgga gcattctatg gatcaccatg 361 ccggacatga tcatggtcac agcatgcacg atatgcatgg ggacgctcat gccggtcacg 421 ggattttatc actgaccact acaacaacaa caacaatgcc accaacagtg atacccgcca 481 cacatgagca cttgcatcat gcaccagctg gacagagcga tatgggacac atgaaccata 541 tgaatcacat gatgaatcat atgatgtcta tgtcgtttca ttttggctat gaagaaacaa 601 tactatttga attttggaaa attgatagca tcgctggctt aataggttcc atggcaggca 661 tattcatatt ggccgtttta tatgaaggtt taaaatatta tcgggaattt ttgttttgga 721 aaacatacaa tttattggaa tatcgcccag ttacggggcc acaaactaat ccagaggtgg 781 gacaaataca accagcgccc agcaatccaa caccggtgca atatgtcgga gaagttattc 841 ataagcaacc gccaacaatg ttctcgctga atcactttat tcagactgct ttgcatatgg 901 tacaggttac agtatccttc ctactcatgt tgatattcat gacctacaat gtgtggctgt 961 gtttggccgt tgttgtggga gctgccgtcg gctatttcct tttctgctgg aagaaatccg 1021 taattgtgga tgtaactgaa cattgtcact agcaaaagac ccattatgaa tgttgggaag 1081 ctgcttggcg accaaagcga ggaatgcagc tggcgcgtga caacgcaact tcaatgcaac 1141 gtcagctact tataaacgat gacctacaat agacaaacaa aacaaaacaa caaaacaaac 1201 aaaca