Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366800 1067 bp mRNA linear INV 02-SEP-2023 1 (LOC106081969), transcript variant X3, mRNA. ACCESSION XM_059366800 VERSION XM_059366800.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1067 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1067 /gene="LOC106081969" /note="high affinity copper uptake protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106081969" CDS 138..914 /gene="LOC106081969" /codon_start=1 /product="high affinity copper uptake protein 1 isoform X1" /protein_id="XP_059222783.1" /db_xref="GeneID:106081969" /translation="MDHSEHSMDHHAGHDHGHSMHDMHGDAHAGHGILSLTTTTTTTM PPTVIPATHEHLHHAPAGQSDMGHMNHMNHMMNHMMSMSFHFGYEETILFEFWKIDSI AGLIGSMAGIFILAVLYEGLKYYREFLFWKTYNLLEYRPVTGPQTNPEVGQIQPAPSN PTPVQYVGEVIHKQPFIKWCNMDKFSRNALLWPTMFSLNHFIQTALHMVQVTVSFLLM LIFMTYNVWLCLAVVVGAAVGYFLFCWKKSVIVDVTEHCH" polyA_site 1067 /gene="LOC106081969" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgctgttgcc tcgatggttt aaagtttatt gcaagtgtta ttgctgtgcc tccttatcaa 61 ttgtgttttc aatgggttga catatatcct ataacgttgg catacctgta caagttttac 121 atctttaaca gttcataatg gaccattcgg agcattctat ggatcaccat gccggacatg 181 atcatggtca cagcatgcac gatatgcatg gggacgctca tgccggtcac gggattttat 241 cactgaccac tacaacaaca acaacaatgc caccaacagt gatacccgcc acacatgagc 301 acttgcatca tgcaccagct ggacagagcg atatgggaca catgaaccat atgaatcaca 361 tgatgaatca tatgatgtct atgtcgtttc attttggcta tgaagaaaca atactatttg 421 aattttggaa aattgatagc atcgctggct taataggttc catggcaggc atattcatat 481 tggccgtttt atatgaaggt ttaaaatatt atcgggaatt tttgttttgg aaaacataca 541 atttattgga atatcgccca gttacggggc cacaaactaa tccagaggtg ggacaaatac 601 aaccagcgcc cagcaatcca acaccggtgc aatatgtcgg agaagttatt cataagcaac 661 catttataaa atggtgtaac atggataaat ttagcagaaa tgctttgttg tggccaacaa 721 tgttctcgct gaatcacttt attcagactg ctttgcatat ggtacaggtt acagtatcct 781 tcctactcat gttgatattc atgacctaca atgtgtggct gtgtttggcc gttgttgtgg 841 gagctgccgt cggctatttc cttttctgct ggaagaaatc cgtaattgtg gatgtaactg 901 aacattgtca ctagcaaaag acccattatg aatgttggga agctgcttgg cgaccaaagc 961 gaggaatgca gctggcgcgt gacaacgcaa cttcaatgca acgtcagcta cttataaacg 1021 atgacctaca atagacaaac aaaacaaaac aacaaaacaa acaaaca