Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans high affinity copper uptake protein


LOCUS       XM_059366800            1067 bp    mRNA    linear   INV 02-SEP-2023
            1 (LOC106081969), transcript variant X3, mRNA.
ACCESSION   XM_059366800
VERSION     XM_059366800.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1067
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1067
                     /gene="LOC106081969"
                     /note="high affinity copper uptake protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 8 Proteins"
                     /db_xref="GeneID:106081969"
     CDS             138..914
                     /gene="LOC106081969"
                     /codon_start=1
                     /product="high affinity copper uptake protein 1 isoform
                     X1"
                     /protein_id="XP_059222783.1"
                     /db_xref="GeneID:106081969"
                     /translation="MDHSEHSMDHHAGHDHGHSMHDMHGDAHAGHGILSLTTTTTTTM
                     PPTVIPATHEHLHHAPAGQSDMGHMNHMNHMMNHMMSMSFHFGYEETILFEFWKIDSI
                     AGLIGSMAGIFILAVLYEGLKYYREFLFWKTYNLLEYRPVTGPQTNPEVGQIQPAPSN
                     PTPVQYVGEVIHKQPFIKWCNMDKFSRNALLWPTMFSLNHFIQTALHMVQVTVSFLLM
                     LIFMTYNVWLCLAVVVGAAVGYFLFCWKKSVIVDVTEHCH"
     polyA_site      1067
                     /gene="LOC106081969"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgctgttgcc tcgatggttt aaagtttatt gcaagtgtta ttgctgtgcc tccttatcaa
       61 ttgtgttttc aatgggttga catatatcct ataacgttgg catacctgta caagttttac
      121 atctttaaca gttcataatg gaccattcgg agcattctat ggatcaccat gccggacatg
      181 atcatggtca cagcatgcac gatatgcatg gggacgctca tgccggtcac gggattttat
      241 cactgaccac tacaacaaca acaacaatgc caccaacagt gatacccgcc acacatgagc
      301 acttgcatca tgcaccagct ggacagagcg atatgggaca catgaaccat atgaatcaca
      361 tgatgaatca tatgatgtct atgtcgtttc attttggcta tgaagaaaca atactatttg
      421 aattttggaa aattgatagc atcgctggct taataggttc catggcaggc atattcatat
      481 tggccgtttt atatgaaggt ttaaaatatt atcgggaatt tttgttttgg aaaacataca
      541 atttattgga atatcgccca gttacggggc cacaaactaa tccagaggtg ggacaaatac
      601 aaccagcgcc cagcaatcca acaccggtgc aatatgtcgg agaagttatt cataagcaac
      661 catttataaa atggtgtaac atggataaat ttagcagaaa tgctttgttg tggccaacaa
      721 tgttctcgct gaatcacttt attcagactg ctttgcatat ggtacaggtt acagtatcct
      781 tcctactcat gttgatattc atgacctaca atgtgtggct gtgtttggcc gttgttgtgg
      841 gagctgccgt cggctatttc cttttctgct ggaagaaatc cgtaattgtg gatgtaactg
      901 aacattgtca ctagcaaaag acccattatg aatgttggga agctgcttgg cgaccaaagc
      961 gaggaatgca gctggcgcgt gacaacgcaa cttcaatgca acgtcagcta cttataaacg
     1021 atgacctaca atagacaaac aaaacaaaac aacaaaacaa acaaaca