Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans oocyte zinc finger protein


LOCUS       XM_059366775            1104 bp    mRNA    linear   INV 02-SEP-2023
            XlCOF19-like (LOC131996809), mRNA.
ACCESSION   XM_059366775
VERSION     XM_059366775.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1104
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1104
                     /gene="LOC131996809"
                     /note="oocyte zinc finger protein XlCOF19-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:131996809"
     CDS             75..698
                     /gene="LOC131996809"
                     /codon_start=1
                     /product="oocyte zinc finger protein XlCOF19-like"
                     /protein_id="XP_059222758.1"
                     /db_xref="GeneID:131996809"
                     /translation="MVKKIITRSNSYTCDHCGKAFKFKGNLRYHLFSHIPGEGRYTCD
                     IDQCGRTFKNPKRLSDHRRRYHLNRENYICEYCGYQTRIKCNLAVHMRQRHTGEKPYC
                     CEYCAIGFSSSYQLSAHKSSHEERFANDDNDDGRHWSYCPICGEKFANSKTLYHHKST
                     HTEEKEYKCELCAKTYQQSSGLSRHKRWHKSQQAKCMNTMVDKEYTK"
ORIGIN      
        1 attgctgttt ccctttactc gagaagagac acggtagagc ggtgcggcgg gcatctcatt
       61 agtgcgatat agtaatggtc aaaaagataa taacgcgttc aaattcttac acctgcgacc
      121 attgtggtaa agccttcaag ttcaaaggaa atttacgtta tcatctattc agccacattc
      181 ctggagaggg taggtacact tgcgatattg atcaatgtgg tcgcacattt aagaatccca
      241 aacgattgag tgatcaccgg agacgttacc atttgaatag ggaaaactac atttgtgaat
      301 actgtggcta ccagacgcgt ataaaatgca atctggctgt ccatatgcgc caaagacata
      361 cgggtgaaaa gccgtattgc tgcgaatact gtgccattgg cttctcttcg tcataccaat
      421 taagtgctca taagagcagc cacgaagaac gatttgcaaa tgatgacaat gatgatggcc
      481 gtcattggtc gtattgtccg atatgtggcg aaaaattcgc aaatagcaaa acgttgtatc
      541 atcataaatc aacacatacc gaagaaaagg aatacaagtg cgaactatgc gctaaaacat
      601 atcagcaatc gtcaggacta tctcgtcata agagatggca taagagccaa caggcaaaat
      661 gcatgaatac tatggttgat aaagagtaca ccaaataaaa gaaccgctaa taaataaaat
      721 tcttggttaa atcaagtaaa attgagttac tatctatact tgataaaacc agggggcgaa
      781 ttactgcttt cagattaaat attatttaaa atttttaatc tcaaaacaca ccgtacaaat
      841 tttgtataat gtatctgatt gttaatctca taacagcagc actgcgcctt ttgatatagt
      901 acatttgggt gttactccaa taaaaacagc aaattttttt catccaaaga tgtagaaaaa
      961 atgtagttta atattttcaa tgtttttttt aatcggttaa ccaaatgtaa tttaaataag
     1021 ttcttgggaa ctaatacgaa aaacgcaacg taaagtcggc ataaaaaaaa ttcaccaaag
     1081 atactataac aggtaaaccg acta