Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366772 640 bp mRNA linear INV 02-SEP-2023 (LOC106080873), transcript variant X2, mRNA. ACCESSION XM_059366772 VERSION XM_059366772.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..640 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..640 /gene="LOC106080873" /note="transmembrane protein 242; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106080873" CDS 107..532 /gene="LOC106080873" /codon_start=1 /product="transmembrane protein 242 isoform X2" /protein_id="XP_059222755.1" /db_xref="GeneID:106080873" /translation="MNERQAPISTDDKNHRIQAAAFLGLVGGISALFGFSKTLGKAKK SESKLVEKGGTKTLLLLDEGSALAMRALGWGTLYAVLGTGAFCFGVWKLSGAKNMEEF RLKMGSGLPKLTSDQPPTSRTDFESLTDLMKYLAAWGKE" polyA_site 640 /gene="LOC106080873" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acgacgcata ccaaaaaaca tgtaaataaa acaaagtgag agagagaaaa agtaactcgt 61 aaaaaaacaa atacggagaa acacaaatca attacaacat agaaagatga atgaacgtca 121 agcacctatt tcaactgacg acaaaaacca tagaatacaa gctgcggctt ttcttggttt 181 ggttggaggg atttcagctt tatttgggtt ttcaaagact ctaggcaaag ccaagaaatc 241 cgaatcaaag ctagtggaga aaggaggtac aaaaaccctt ttgttattgg acgaaggatc 301 ggccttagct atgcgcgctt tgggttgggg aacattatat gctgtattag gcactggggc 361 gttttgcttt ggcgtttgga aattgtctgg tgcaaagaat atggaagaat ttcgtttaaa 421 aatgggaagc ggactgccaa aacttacaag cgatcagcca cccactagtc gcaccgattt 481 tgagagtctg actgatctaa tgaaatattt ggctgcctgg ggaaaggaat gataaacaaa 541 aaataatatt tgcattagtt attagtaaac cacacatttt tgaaaataat ttactttttt 601 attgaaactc attaaaaact ccattttgtg tcagccagaa