Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transmembrane protein 242


LOCUS       XM_059366772             640 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080873), transcript variant X2, mRNA.
ACCESSION   XM_059366772
VERSION     XM_059366772.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..640
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..640
                     /gene="LOC106080873"
                     /note="transmembrane protein 242; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106080873"
     CDS             107..532
                     /gene="LOC106080873"
                     /codon_start=1
                     /product="transmembrane protein 242 isoform X2"
                     /protein_id="XP_059222755.1"
                     /db_xref="GeneID:106080873"
                     /translation="MNERQAPISTDDKNHRIQAAAFLGLVGGISALFGFSKTLGKAKK
                     SESKLVEKGGTKTLLLLDEGSALAMRALGWGTLYAVLGTGAFCFGVWKLSGAKNMEEF
                     RLKMGSGLPKLTSDQPPTSRTDFESLTDLMKYLAAWGKE"
     polyA_site      640
                     /gene="LOC106080873"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acgacgcata ccaaaaaaca tgtaaataaa acaaagtgag agagagaaaa agtaactcgt
       61 aaaaaaacaa atacggagaa acacaaatca attacaacat agaaagatga atgaacgtca
      121 agcacctatt tcaactgacg acaaaaacca tagaatacaa gctgcggctt ttcttggttt
      181 ggttggaggg atttcagctt tatttgggtt ttcaaagact ctaggcaaag ccaagaaatc
      241 cgaatcaaag ctagtggaga aaggaggtac aaaaaccctt ttgttattgg acgaaggatc
      301 ggccttagct atgcgcgctt tgggttgggg aacattatat gctgtattag gcactggggc
      361 gttttgcttt ggcgtttgga aattgtctgg tgcaaagaat atggaagaat ttcgtttaaa
      421 aatgggaagc ggactgccaa aacttacaag cgatcagcca cccactagtc gcaccgattt
      481 tgagagtctg actgatctaa tgaaatattt ggctgcctgg ggaaaggaat gataaacaaa
      541 aaataatatt tgcattagtt attagtaaac cacacatttt tgaaaataat ttactttttt
      601 attgaaactc attaaaaact ccattttgtg tcagccagaa