Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transmembrane protein 242


LOCUS       XM_059366771             805 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080873), transcript variant X1, mRNA.
ACCESSION   XM_059366771
VERSION     XM_059366771.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..805
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..805
                     /gene="LOC106080873"
                     /note="transmembrane protein 242; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106080873"
     CDS             272..697
                     /gene="LOC106080873"
                     /codon_start=1
                     /product="transmembrane protein 242 isoform X1"
                     /protein_id="XP_059222754.1"
                     /db_xref="GeneID:106080873"
                     /translation="MNERQAPISTDDKNHRIQAAAFLGLVGGISALFGFSKTLGKAKK
                     SESKLVEKGGTKTLLLLDEGSALAMRALGWGTLYAVLGTGAFCFGVWKLSGAKNMEEF
                     RLKMGSGLPKLTSDQPPTSRTDFESLTDLMKYLAAWGKE"
     polyA_site      805
                     /gene="LOC106080873"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acggagaaac acaaatcaat tacaacatag aaagatgaat gaacgtcaag cacctatttc
       61 aactgacgac aaaaaccata gaatacaagc ccactgttct gccatatcac tgaacatatc
      121 ccatatcgtc tcggcaatca gtcaatggca tggctccgac gactcatacc aaaataaaac
      181 aaacatgtaa ataaaacaaa gtgggagaga gaaaaagtaa ctcgtaaaaa aacaaatacg
      241 gagaaacaca aatcaattac aacatagaaa gatgaatgaa cgtcaagcac ccatttcaac
      301 tgacgacaaa aaccatagaa tacaagctgc ggcttttctt ggtttggttg gagggatttc
      361 agctttattt gggttttcaa agactctagg caaagccaag aaatccgaat caaagctagt
      421 ggagaaagga ggtacaaaaa cccttttgtt attggacgaa ggatcggcct tagctatgcg
      481 cgctttgggt tggggaacat tatatgctgt attaggcact ggggcgtttt gctttggcgt
      541 ttggaaattg tctggtgcaa agaatatgga agaatttcgt ttaaaaatgg gaagcggact
      601 gccaaaactt acaagcgatc agccacccac tagtcgcacc gattttgaga gtctgactga
      661 tctaatgaaa tatttggctg cctggggaaa ggaatgataa acaaaaaata atatttgcat
      721 tagttattag taaaccacac atttttgaaa ataatttact tttttattga aactcattaa
      781 aaactccatt ttgtgtcagc cagaa