Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366771 805 bp mRNA linear INV 02-SEP-2023 (LOC106080873), transcript variant X1, mRNA. ACCESSION XM_059366771 VERSION XM_059366771.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..805 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..805 /gene="LOC106080873" /note="transmembrane protein 242; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106080873" CDS 272..697 /gene="LOC106080873" /codon_start=1 /product="transmembrane protein 242 isoform X1" /protein_id="XP_059222754.1" /db_xref="GeneID:106080873" /translation="MNERQAPISTDDKNHRIQAAAFLGLVGGISALFGFSKTLGKAKK SESKLVEKGGTKTLLLLDEGSALAMRALGWGTLYAVLGTGAFCFGVWKLSGAKNMEEF RLKMGSGLPKLTSDQPPTSRTDFESLTDLMKYLAAWGKE" polyA_site 805 /gene="LOC106080873" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acggagaaac acaaatcaat tacaacatag aaagatgaat gaacgtcaag cacctatttc 61 aactgacgac aaaaaccata gaatacaagc ccactgttct gccatatcac tgaacatatc 121 ccatatcgtc tcggcaatca gtcaatggca tggctccgac gactcatacc aaaataaaac 181 aaacatgtaa ataaaacaaa gtgggagaga gaaaaagtaa ctcgtaaaaa aacaaatacg 241 gagaaacaca aatcaattac aacatagaaa gatgaatgaa cgtcaagcac ccatttcaac 301 tgacgacaaa aaccatagaa tacaagctgc ggcttttctt ggtttggttg gagggatttc 361 agctttattt gggttttcaa agactctagg caaagccaag aaatccgaat caaagctagt 421 ggagaaagga ggtacaaaaa cccttttgtt attggacgaa ggatcggcct tagctatgcg 481 cgctttgggt tggggaacat tatatgctgt attaggcact ggggcgtttt gctttggcgt 541 ttggaaattg tctggtgcaa agaatatgga agaatttcgt ttaaaaatgg gaagcggact 601 gccaaaactt acaagcgatc agccacccac tagtcgcacc gattttgaga gtctgactga 661 tctaatgaaa tatttggctg cctggggaaa ggaatgataa acaaaaaata atatttgcat 721 tagttattag taaaccacac atttttgaaa ataatttact tttttattga aactcattaa 781 aaactccatt ttgtgtcagc cagaa