Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NFU1 iron-sulfur cluster scaffold


LOCUS       XM_059366769            1018 bp    mRNA    linear   INV 02-SEP-2023
            homolog, mitochondrial (LOC106080841), mRNA.
ACCESSION   XM_059366769
VERSION     XM_059366769.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1018
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1018
                     /gene="LOC106080841"
                     /note="NFU1 iron-sulfur cluster scaffold homolog,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins"
                     /db_xref="GeneID:106080841"
     CDS             66..905
                     /gene="LOC106080841"
                     /codon_start=1
                     /product="NFU1 iron-sulfur cluster scaffold homolog,
                     mitochondrial"
                     /protein_id="XP_059222752.1"
                     /db_xref="GeneID:106080841"
                     /translation="MSKIIFNAIRNSRNINKLAYGNVIQQRSLMQNVGILMGAQGNGK
                     LLKTSNTVFRHMFPQQQRTMFIQTQDTPNPDSLKFLPGIEVLGKGNTYDFPAVSAAYC
                     SPLAKLLFRIEGVRSVFFGSDFITISKEEEAEWGIIKPEVFAVIMDFFSSGLPILNEA
                     KPNTDTQINDDDDDTVMMIKELLDSRIRPTVQEDGGDIIFMGFENGIVKLKMQGSCSS
                     CPSSIVTLKNGVENMLQFYIPEVQGVEQVFDAVDKIVDKEFEKLEQNIKLKEKGGDTA
                     EAK"
     polyA_site      1018
                     /gene="LOC106080841"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agctgtgttt atagtaaata aaatgttagt taagtacata gaataacgaa atttgaaagg
       61 gcaaaatgtc taaaataatt ttcaacgcaa ttagaaactc acgtaatata aacaaattgg
      121 cttatggaaa tgttatccaa caaaggagtt taatgcagaa tgttgggatc ctgatgggag
      181 cacaaggcaa tggcaaactt ttgaaaacta gcaacacggt ttttcggcat atgtttcctc
      241 aacaacagcg gacaatgttc atacagacac aggacacacc gaatccagat agtttaaaat
      301 ttcttcctgg cattgaggtt ctaggcaaag gaaacactta tgatttcccg gcagtatcgg
      361 cagcttattg cagtccattg gctaaacttt tatttcgtat agagggtgtg cgatctgtgt
      421 tctttggtag tgattttata accatttcca aagaagagga agctgagtgg ggtattataa
      481 aacctgaggt gtttgctgtt atcatggact ttttttccag tggcttaccc atattgaatg
      541 aggcaaaacc aaataccgac acacaaatta acgatgatga tgatgacaca gttatgatga
      601 tcaaagagct gttggatagt cgaattagac caacggtcca agaagacggt ggagatataa
      661 tattcatggg cttcgagaat ggcattgtga aattaaaaat gcaaggttct tgttcttcat
      721 gtccaagctc gattgtcact ctcaaaaatg gagtcgaaaa tatgttacaa ttttatatac
      781 cagaagtaca aggtgtggaa caagttttcg acgctgtgga taaaatagtt gacaaggaat
      841 ttgaaaagtt ggaacagaac attaaattaa aggagaaagg tggtgacaca gccgaagcaa
      901 aataaatcaa tgtacttgga gacactagct gttatgcgac agaaactttg tgaaaaccta
      961 aaatttactg agcttcgaat aataaaatgt taaagattag tttaattcat tattacaa