Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366756 348 bp mRNA linear INV 02-SEP-2023 transcript variant X3, mRNA. ACCESSION XM_059366756 VERSION XM_059366756.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..348 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..348 /gene="LOC106084219" /note="cytochrome b5 type B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106084219" CDS 79..348 /gene="LOC106084219" /codon_start=1 /product="cytochrome b5 type B isoform X2" /protein_id="XP_059222739.1" /db_xref="GeneID:106084219" /translation="MVNEIPLETVKQHNKPTDLWVVIENKVYDVTKFRSEHPGGEESL DEVAGRDGTKEFMEVGHSQEAREIMKKFYIGDLAAKDCKGKLPLR" ORIGIN 1 tttattttct aatgtacatc taacatttcc tttggaattt tcatttgcaa tttgtccagg 61 aaagccacgt gaacaaaaat ggtgaacgag atacctcttg aaacggtgaa gcagcacaat 121 aagccaacag atttgtgggt tgtaatagag aacaaagtct acgatgtaac aaagttccgt 181 agtgagcatc caggaggcga agagtccttg gacgaagtgg caggtagaga cggtaccaag 241 gagtttatgg aggtcggtca tagccaggaa gccagggaga taatgaaaaa attttatatt 301 ggagatctgg ctgcgaaaga ctgtaaagga aagcttccgt taaggtaa