Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome b5 type B (LOC106084219),


LOCUS       XM_059366756             348 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X3, mRNA.
ACCESSION   XM_059366756
VERSION     XM_059366756.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..348
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..348
                     /gene="LOC106084219"
                     /note="cytochrome b5 type B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106084219"
     CDS             79..348
                     /gene="LOC106084219"
                     /codon_start=1
                     /product="cytochrome b5 type B isoform X2"
                     /protein_id="XP_059222739.1"
                     /db_xref="GeneID:106084219"
                     /translation="MVNEIPLETVKQHNKPTDLWVVIENKVYDVTKFRSEHPGGEESL
                     DEVAGRDGTKEFMEVGHSQEAREIMKKFYIGDLAAKDCKGKLPLR"
ORIGIN      
        1 tttattttct aatgtacatc taacatttcc tttggaattt tcatttgcaa tttgtccagg
       61 aaagccacgt gaacaaaaat ggtgaacgag atacctcttg aaacggtgaa gcagcacaat
      121 aagccaacag atttgtgggt tgtaatagag aacaaagtct acgatgtaac aaagttccgt
      181 agtgagcatc caggaggcga agagtccttg gacgaagtgg caggtagaga cggtaccaag
      241 gagtttatgg aggtcggtca tagccaggaa gccagggaga taatgaaaaa attttatatt
      301 ggagatctgg ctgcgaaaga ctgtaaagga aagcttccgt taaggtaa