Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366755 858 bp mRNA linear INV 02-SEP-2023 (LOC131996800), mRNA. ACCESSION XM_059366755 VERSION XM_059366755.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..858 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..858 /gene="LOC131996800" /note="uncharacterized LOC131996800; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131996800" CDS 337..852 /gene="LOC131996800" /codon_start=1 /product="uncharacterized protein LOC131996800" /protein_id="XP_059222738.1" /db_xref="GeneID:131996800" /translation="MSQGKNKIKFQGKECFSRMNFLYQASILMAGKNDCLASYYGELC KNIGKKSVLRMEPSIKRTLCKRCSLAQQPSITSEILVRKGKTTNIYPTSSIDESSELI CKCKLCGHSKKFVVNSSYKFWLENKDESVAEVLETEGSKNRRVSTLVLSKTAVLNKQT EQRQNIQSIGH" polyA_site 858 /gene="LOC131996800" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaaatttaaa ttaacaacat tttactgaga gagctggaaa aacaaaaaat taataatagt 61 gcactacagc atttatagtg gaatgtgaaa aaaatcaatt tccaaaacat ctcaactagt 121 gtgaacggtt gggatgtttt ccaaaacgac ataagcaaat ccagtcaatg tagacatagc 181 attactcccc tcacacaaac taagaaccac cacaagtaat attacgattt gaaacaaata 241 tgggaacaca ccttataagt cataaaataa tatattgctt cctgccgaat cttaaagaac 301 ctcttcagga caaaaattag caaagtttag gatattatgt cccagggaaa aaataaaatt 361 aaatttcaag gaaaggaatg cttcagcaga atgaattttc tttatcaagc ctccatattg 421 atggcaggga aaaatgactg tttagcatcg tattacggtg aactgtgcaa aaatattgga 481 aaaaagtctg tattgagaat ggagcccagt atcaagagaa cattgtgcaa acgttgttct 541 ttggctcagc aacctagcat aacctccgaa atccttgtcc gaaaggggaa aacgacaaat 601 atttatccca catcctccat agatgagagc tccgagttga tatgcaaatg caagttatgt 661 ggacatagca aaaaattcgt tgtcaattct agttataagt tttggttaga aaataaagat 721 gaatcagtgg ctgaagtttt ggaaacagag gggtcaaaga atcggcgtgt aagcacattg 781 gtgctgtcaa aaacagctgt gttaaataaa caaactgaac aaagacaaaa cattcagtca 841 attggacatt agacccga