Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996800


LOCUS       XM_059366755             858 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996800), mRNA.
ACCESSION   XM_059366755
VERSION     XM_059366755.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..858
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..858
                     /gene="LOC131996800"
                     /note="uncharacterized LOC131996800; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996800"
     CDS             337..852
                     /gene="LOC131996800"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996800"
                     /protein_id="XP_059222738.1"
                     /db_xref="GeneID:131996800"
                     /translation="MSQGKNKIKFQGKECFSRMNFLYQASILMAGKNDCLASYYGELC
                     KNIGKKSVLRMEPSIKRTLCKRCSLAQQPSITSEILVRKGKTTNIYPTSSIDESSELI
                     CKCKLCGHSKKFVVNSSYKFWLENKDESVAEVLETEGSKNRRVSTLVLSKTAVLNKQT
                     EQRQNIQSIGH"
     polyA_site      858
                     /gene="LOC131996800"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaatttaaa ttaacaacat tttactgaga gagctggaaa aacaaaaaat taataatagt
       61 gcactacagc atttatagtg gaatgtgaaa aaaatcaatt tccaaaacat ctcaactagt
      121 gtgaacggtt gggatgtttt ccaaaacgac ataagcaaat ccagtcaatg tagacatagc
      181 attactcccc tcacacaaac taagaaccac cacaagtaat attacgattt gaaacaaata
      241 tgggaacaca ccttataagt cataaaataa tatattgctt cctgccgaat cttaaagaac
      301 ctcttcagga caaaaattag caaagtttag gatattatgt cccagggaaa aaataaaatt
      361 aaatttcaag gaaaggaatg cttcagcaga atgaattttc tttatcaagc ctccatattg
      421 atggcaggga aaaatgactg tttagcatcg tattacggtg aactgtgcaa aaatattgga
      481 aaaaagtctg tattgagaat ggagcccagt atcaagagaa cattgtgcaa acgttgttct
      541 ttggctcagc aacctagcat aacctccgaa atccttgtcc gaaaggggaa aacgacaaat
      601 atttatccca catcctccat agatgagagc tccgagttga tatgcaaatg caagttatgt
      661 ggacatagca aaaaattcgt tgtcaattct agttataagt tttggttaga aaataaagat
      721 gaatcagtgg ctgaagtttt ggaaacagag gggtcaaaga atcggcgtgt aagcacattg
      781 gtgctgtcaa aaacagctgt gttaaataaa caaactgaac aaagacaaaa cattcagtca
      841 attggacatt agacccga