Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans microsomal glutathione S-transferase


LOCUS       XM_059366721             769 bp    mRNA    linear   INV 02-SEP-2023
            1-like (LOC106094514), transcript variant X2, mRNA.
ACCESSION   XM_059366721
VERSION     XM_059366721.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..769
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..769
                     /gene="LOC106094514"
                     /note="microsomal glutathione S-transferase 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 62 Proteins"
                     /db_xref="GeneID:106094514"
     CDS             154..615
                     /gene="LOC106094514"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1-like
                     isoform X2"
                     /protein_id="XP_059222704.1"
                     /db_xref="GeneID:106094514"
                     /translation="MAKDALDLLNFKNEVFKSYLFWSSVLLLKMLLMSLLTGLQRFRT
                     QTFANPEDCLLSKKDKVAYDNPHIERVRRAHLNDLENILPFFIAGLFYVLTDPSAFLA
                     INLFRLVAAARILHTIVYAVVVIPQPARFLAYGAAYLPTIYMASQVVIFVF"
     polyA_site      769
                     /gene="LOC106094514"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ataacaatgc atcagcagtt aattgcgaaa attgtggaat aaaacgcaaa gcttcaatga
       61 ttctccagcc agttgtaatt taaaatcgtg tgctgtttct ccaagtaggt agtcgcaaac
      121 ctcaaacaat ttttttatct gtttaattcc aaaatggcaa aagacgcatt ggatctatta
      181 aattttaaga atgaagtctt caagtcatat ctcttttggt caagtgtttt gttgcttaaa
      241 atgttactca tgtcactatt gacaggctta caacgttttc ggacacagac ttttgccaat
      301 cctgaagact gtttattgtc taaaaaggat aaagtcgcct atgacaatcc ccatattgaa
      361 cgtgttcgca gagctcatct aaatgatctg gaaaacattt tgcccttctt cattgctgga
      421 ctgttctatg ttctaacaga tccctcggcc ttcttggcca tcaacctatt ccgacttgtt
      481 gccgctgctc gcatccttca cactattgtt tatgccgttg ttgttatacc tcaacctgca
      541 cgttttttag cctacggtgc ggcctatctc cccacaatct acatggcttc ccaagtggtt
      601 atatttgttt tctaggacat atatatagat tgttataaga aagaagagta tgtacttatt
      661 tttttaaaga ttattatgga acactaacaa gtataaaaaa ttggatattt tgttaaaaga
      721 aaatttttga tattagaaat acatatctac tacagaaaac aaaatcaaa