Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans microsomal glutathione S-transferase


LOCUS       XM_059366720             757 bp    mRNA    linear   INV 02-SEP-2023
            1-like (LOC106094514), transcript variant X1, mRNA.
ACCESSION   XM_059366720
VERSION     XM_059366720.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..757
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..757
                     /gene="LOC106094514"
                     /note="microsomal glutathione S-transferase 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 34 Proteins"
                     /db_xref="GeneID:106094514"
     CDS             147..608
                     /gene="LOC106094514"
                     /codon_start=1
                     /product="microsomal glutathione S-transferase 1-like
                     isoform X1"
                     /protein_id="XP_059222703.1"
                     /db_xref="GeneID:106094514"
                     /translation="MAKDALDLLNFKNEVFKSYLFWSSVLLLKMLLMSLLTGLQRFRT
                     QTFANPEDCILTKKDKIAYDNPHIERVRRAHRNDMENILPFFTAGFFYVLTNPSALLA
                     INLFRLVGVARIIHTIVYAVVVVPQPARGISFFAAFIPTVYMALQVAIFAL"
     polyA_site      757
                     /gene="LOC106094514"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgcatcagca gttaattgcg aaaattgtgg aataaaacgc aaagcttcaa tgattctcca
       61 gccagttgta atttaaaatc gtgtgctgtt tctccaagta ggtagtcgca aacctcaaac
      121 aattttttta tctgtttaat tccaaaatgg caaaagacgc attggatcta ttaaatttta
      181 agaatgaagt cttcaagtca tatctctttt ggtcaagtgt tttgttgctt aaaatgttac
      241 tcatgtcact attgacaggc ttacaacgtt ttcggacaca gacctttgcc aatcctgaag
      301 attgtatatt gactaaaaag gacaaaattg cttatgacaa tccccatatc gaacgtgtcc
      361 gaagggctca tcgcaatgac atggagaata ttttgccatt ctttaccgct ggattcttct
      421 atgttctaac gaatccctct gccttattgg ctatcaactt gttccgtctt gtaggcgttg
      481 ctcgtattat tcacacaatc gtttatgctg ttgttgttgt ccctcagcct gctcgtggta
      541 tatccttttt tgcagccttc attcccacgg tttatatggc tttgcaagtg gctatatttg
      601 cattgtagaa tagtttgttt ttgaaatact acacaaagta tttttgttgt aattaagtgg
      661 caattgtgtt gtgttgtttg ttgtagttaa gtgcatattt caaataaaaa ccaaatactg
      721 tattaaatta agggtacaga aggaacataa caatgaa