Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366720 757 bp mRNA linear INV 02-SEP-2023 1-like (LOC106094514), transcript variant X1, mRNA. ACCESSION XM_059366720 VERSION XM_059366720.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..757 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..757 /gene="LOC106094514" /note="microsomal glutathione S-transferase 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 34 Proteins" /db_xref="GeneID:106094514" CDS 147..608 /gene="LOC106094514" /codon_start=1 /product="microsomal glutathione S-transferase 1-like isoform X1" /protein_id="XP_059222703.1" /db_xref="GeneID:106094514" /translation="MAKDALDLLNFKNEVFKSYLFWSSVLLLKMLLMSLLTGLQRFRT QTFANPEDCILTKKDKIAYDNPHIERVRRAHRNDMENILPFFTAGFFYVLTNPSALLA INLFRLVGVARIIHTIVYAVVVVPQPARGISFFAAFIPTVYMALQVAIFAL" polyA_site 757 /gene="LOC106094514" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgcatcagca gttaattgcg aaaattgtgg aataaaacgc aaagcttcaa tgattctcca 61 gccagttgta atttaaaatc gtgtgctgtt tctccaagta ggtagtcgca aacctcaaac 121 aattttttta tctgtttaat tccaaaatgg caaaagacgc attggatcta ttaaatttta 181 agaatgaagt cttcaagtca tatctctttt ggtcaagtgt tttgttgctt aaaatgttac 241 tcatgtcact attgacaggc ttacaacgtt ttcggacaca gacctttgcc aatcctgaag 301 attgtatatt gactaaaaag gacaaaattg cttatgacaa tccccatatc gaacgtgtcc 361 gaagggctca tcgcaatgac atggagaata ttttgccatt ctttaccgct ggattcttct 421 atgttctaac gaatccctct gccttattgg ctatcaactt gttccgtctt gtaggcgttg 481 ctcgtattat tcacacaatc gtttatgctg ttgttgttgt ccctcagcct gctcgtggta 541 tatccttttt tgcagccttc attcccacgg tttatatggc tttgcaagtg gctatatttg 601 cattgtagaa tagtttgttt ttgaaatact acacaaagta tttttgttgt aattaagtgg 661 caattgtgtt gtgttgtttg ttgtagttaa gtgcatattt caaataaaaa ccaaatactg 721 tattaaatta agggtacaga aggaacataa caatgaa