Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996784


LOCUS       XM_059366703            1021 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996784), mRNA.
ACCESSION   XM_059366703
VERSION     XM_059366703.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1021
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1021
                     /gene="LOC131996784"
                     /note="uncharacterized LOC131996784; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996784"
     CDS             476..1006
                     /gene="LOC131996784"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996784"
                     /protein_id="XP_059222686.1"
                     /db_xref="GeneID:131996784"
                     /translation="MTMSLIVRVCVCENSRRRHSHWRDNTLHYMIVETKTTQSALKQI
                     KEVFGAIHTKSFPLGTQPWIGMPGQKPVCQPAVVDTCVTSWSETSKILVPNMLRCLAK
                     GTILFPHLVTEGEIALQYHLYIYGCVPASILSACRVSTPHSFAVNALANSTKKGGWKH
                     FDCGKYRFCFLSKIRK"
ORIGIN      
        1 cagcgtatgt acatcgtacg cggagggtca tcgccggcca ttaccataaa atcaaataat
       61 catccatcaa ataaaactga aactccacgc aacaaaactt caccattccc aaggaatacg
      121 gcggggatgg tgatgtgcgt gtttggaaag gcaacccgcg ggcggcatat ataaaaaata
      181 tgaaagagaa tggaaaacgg tacatggtcc gggaaacatg cggctgtgat cacccgtgag
      241 tctagccaat gagccctaaa gcgacaaaaa gacgaaaaag aaacattgcc aaaaatttct
      301 ggctttggcg tccctactag ccgcttgtag taagagggtt gctgcttcat tcacataaac
      361 tccacacaca catgcaatca ccaccagcgt gcttttcata cgtgtacatg catagctgta
      421 ttttcctgtt tcattcattt gggtaaacca taaaaaaaaa cttacattct aataaatgac
      481 gatgtctcta atcgtgcgtg tgtgtgtgtg tgaaaactct cgacgccgcc attcacactg
      541 gcgagataac actttgcact atatgattgt tgaaacaaaa acaacacagt cagctctaaa
      601 acaaattaaa gaggtattcg gggcgataca cacaaaatct tttcccctcg gaacccaacc
      661 gtggattggt atgcctggac aaaaacccgt ctgccaaccg gctgtcgtgg acacatgcgt
      721 tacatcttgg agtgaaacct ctaaaatttt ggtgccgaat atgttgcgct gtctggcaaa
      781 aggtacaatt ctctttcccc atctcgtgac cgagggtgaa atcgcattgc agtatcatct
      841 atacatatat ggctgtgtgc ccgcttctat cctatcagcc tgccgtgtat caacaccaca
      901 ttcatttgcc gtcaatgcct tggccaatag cacaaaaaaa ggaggttgga aacattttga
      961 ttgtggtaaa tatcgttttt gttttctatc aaaaatccgc aagtgaattt gggcattgac
     1021 a