Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366703 1021 bp mRNA linear INV 02-SEP-2023 (LOC131996784), mRNA. ACCESSION XM_059366703 VERSION XM_059366703.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1021 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1021 /gene="LOC131996784" /note="uncharacterized LOC131996784; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996784" CDS 476..1006 /gene="LOC131996784" /codon_start=1 /product="uncharacterized protein LOC131996784" /protein_id="XP_059222686.1" /db_xref="GeneID:131996784" /translation="MTMSLIVRVCVCENSRRRHSHWRDNTLHYMIVETKTTQSALKQI KEVFGAIHTKSFPLGTQPWIGMPGQKPVCQPAVVDTCVTSWSETSKILVPNMLRCLAK GTILFPHLVTEGEIALQYHLYIYGCVPASILSACRVSTPHSFAVNALANSTKKGGWKH FDCGKYRFCFLSKIRK" ORIGIN 1 cagcgtatgt acatcgtacg cggagggtca tcgccggcca ttaccataaa atcaaataat 61 catccatcaa ataaaactga aactccacgc aacaaaactt caccattccc aaggaatacg 121 gcggggatgg tgatgtgcgt gtttggaaag gcaacccgcg ggcggcatat ataaaaaata 181 tgaaagagaa tggaaaacgg tacatggtcc gggaaacatg cggctgtgat cacccgtgag 241 tctagccaat gagccctaaa gcgacaaaaa gacgaaaaag aaacattgcc aaaaatttct 301 ggctttggcg tccctactag ccgcttgtag taagagggtt gctgcttcat tcacataaac 361 tccacacaca catgcaatca ccaccagcgt gcttttcata cgtgtacatg catagctgta 421 ttttcctgtt tcattcattt gggtaaacca taaaaaaaaa cttacattct aataaatgac 481 gatgtctcta atcgtgcgtg tgtgtgtgtg tgaaaactct cgacgccgcc attcacactg 541 gcgagataac actttgcact atatgattgt tgaaacaaaa acaacacagt cagctctaaa 601 acaaattaaa gaggtattcg gggcgataca cacaaaatct tttcccctcg gaacccaacc 661 gtggattggt atgcctggac aaaaacccgt ctgccaaccg gctgtcgtgg acacatgcgt 721 tacatcttgg agtgaaacct ctaaaatttt ggtgccgaat atgttgcgct gtctggcaaa 781 aggtacaatt ctctttcccc atctcgtgac cgagggtgaa atcgcattgc agtatcatct 841 atacatatat ggctgtgtgc ccgcttctat cctatcagcc tgccgtgtat caacaccaca 901 ttcatttgcc gtcaatgcct tggccaatag cacaaaaaaa ggaggttgga aacattttga 961 ttgtggtaaa tatcgttttt gttttctatc aaaaatccgc aagtgaattt gggcattgac 1021 a