Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans REST corepressor (LOC106083564),


LOCUS       XM_059366697            1141 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X6, mRNA.
ACCESSION   XM_059366697
VERSION     XM_059366697.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1141
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1141
                     /gene="LOC106083564"
                     /note="REST corepressor; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106083564"
     CDS             329..1126
                     /gene="LOC106083564"
                     /codon_start=1
                     /product="REST corepressor isoform X3"
                     /protein_id="XP_059222680.1"
                     /db_xref="GeneID:106083564"
                     /translation="MVLAERNSELVRNGRRSRGPSPNGHGASSGSASASAPGGTGTGT
                     PETSSDDDNSIKRNGKSKTKQSEYEEKIRVGRDYQAVCPPLIPEPERKPECLNDRALL
                     VWSPTKEIPDTKLEEYISVAKEKYGYNGEQALGMLFWHKHDLERAVMDLANFTPFPDE
                     WTVEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKKTRHRQSVMDRQEKV
                     KASKEGSSENGSDNGSNEESDNDDKLRCGLTLDKILFTYSSKNTYIF"
ORIGIN      
        1 ttttttgtta cctgcccatt cattgcccag cgttgtgctg ctgcagaagt ctaaaatcac
       61 tgaaaccaga aaaattggcg taaaaattag attttatgta gttgctgcaa tatctgggga
      121 agaatagtag tctaataact ggaaggaatt taggaagaga acagtgaaaa tttaaaacat
      181 tcaatatttt gttttaatac gttcctcatt gattggttgg attgacttgg tgtatcttgt
      241 ttactttgct tttcgctgct gcagcgtgat tcattattgc ttaaggaaaa gtgacgacga
      301 taaatttgaa attattaaca aacaaaaaat ggtactggcc gagcggaatt cagagttagt
      361 gcgcaatggc agacgctctc gaggtcccag tcccaatggc catggtgcaa gttcgggaag
      421 tgccagcgca agtgcaccag gcggaacggg tactggcact cccgaaacat catctgatga
      481 tgacaattct attaaacgga atggaaaatc taaaactaaa caaagcgagt atgaagaaaa
      541 aatccgtgtc ggtcgagact atcaagcggt gtgtccccct ttaatacctg agcccgaaag
      601 aaaacctgaa tgccttaatg atcgcgcttt gctagtgtgg tcacctacaa aagaaatacc
      661 agatactaaa cttgaggaat atatatcagt tgccaaagag aaatatggtt ataatggtga
      721 acaagctttg ggtatgttat tctggcataa acacgatttg gagagagctg ttatggattt
      781 ggcaaacttt acacccttcc ctgatgaatg gacagtggaa gacaaagttt tgtttgaaca
      841 agcatttcaa ttccatggca aaagttttca tcgcatacgt caaatgttgc cagataaatc
      901 cattgctagc ttagtaaaat actattactc atggaaaaag acacgacatc gtcaaagtgt
      961 tatggatcgt caggagaaag taaaagccag caaagaaggt tcttcagaga atggcagtga
     1021 taatggaagc aatgaagaat ccgacaatga tgacaagtta cgttgtggct taactttaga
     1081 caaaatctta tttacctact catcaaagaa cacatacatt ttttaaaata cttattttat
     1141 t