Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366697 1141 bp mRNA linear INV 02-SEP-2023 transcript variant X6, mRNA. ACCESSION XM_059366697 VERSION XM_059366697.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1141 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1141 /gene="LOC106083564" /note="REST corepressor; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106083564" CDS 329..1126 /gene="LOC106083564" /codon_start=1 /product="REST corepressor isoform X3" /protein_id="XP_059222680.1" /db_xref="GeneID:106083564" /translation="MVLAERNSELVRNGRRSRGPSPNGHGASSGSASASAPGGTGTGT PETSSDDDNSIKRNGKSKTKQSEYEEKIRVGRDYQAVCPPLIPEPERKPECLNDRALL VWSPTKEIPDTKLEEYISVAKEKYGYNGEQALGMLFWHKHDLERAVMDLANFTPFPDE WTVEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKKTRHRQSVMDRQEKV KASKEGSSENGSDNGSNEESDNDDKLRCGLTLDKILFTYSSKNTYIF" ORIGIN 1 ttttttgtta cctgcccatt cattgcccag cgttgtgctg ctgcagaagt ctaaaatcac 61 tgaaaccaga aaaattggcg taaaaattag attttatgta gttgctgcaa tatctgggga 121 agaatagtag tctaataact ggaaggaatt taggaagaga acagtgaaaa tttaaaacat 181 tcaatatttt gttttaatac gttcctcatt gattggttgg attgacttgg tgtatcttgt 241 ttactttgct tttcgctgct gcagcgtgat tcattattgc ttaaggaaaa gtgacgacga 301 taaatttgaa attattaaca aacaaaaaat ggtactggcc gagcggaatt cagagttagt 361 gcgcaatggc agacgctctc gaggtcccag tcccaatggc catggtgcaa gttcgggaag 421 tgccagcgca agtgcaccag gcggaacggg tactggcact cccgaaacat catctgatga 481 tgacaattct attaaacgga atggaaaatc taaaactaaa caaagcgagt atgaagaaaa 541 aatccgtgtc ggtcgagact atcaagcggt gtgtccccct ttaatacctg agcccgaaag 601 aaaacctgaa tgccttaatg atcgcgcttt gctagtgtgg tcacctacaa aagaaatacc 661 agatactaaa cttgaggaat atatatcagt tgccaaagag aaatatggtt ataatggtga 721 acaagctttg ggtatgttat tctggcataa acacgatttg gagagagctg ttatggattt 781 ggcaaacttt acacccttcc ctgatgaatg gacagtggaa gacaaagttt tgtttgaaca 841 agcatttcaa ttccatggca aaagttttca tcgcatacgt caaatgttgc cagataaatc 901 cattgctagc ttagtaaaat actattactc atggaaaaag acacgacatc gtcaaagtgt 961 tatggatcgt caggagaaag taaaagccag caaagaaggt tcttcagaga atggcagtga 1021 taatggaagc aatgaagaat ccgacaatga tgacaagtta cgttgtggct taactttaga 1081 caaaatctta tttacctact catcaaagaa cacatacatt ttttaaaata cttattttat 1141 t