Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans la1-like protein 13 (LOC131996780),


LOCUS       XM_059366694             298 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X2, mRNA.
ACCESSION   XM_059366694
VERSION     XM_059366694.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..298
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..298
                     /gene="LOC131996780"
                     /note="la1-like protein 13; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996780"
     CDS             11..298
                     /gene="LOC131996780"
                     /codon_start=1
                     /product="la1-like protein 13 isoform X2"
                     /protein_id="XP_059222677.1"
                     /db_xref="GeneID:131996780"
                     /translation="MYKMKYYIIAVLVTLVILAGVCASDDDSCTIDGHVVKKGEYYHP
                     IGKCERVHCRGSDHISGIGCGVVAIRPGSKCKLIPKDLTKPYPHCCESYEC"
ORIGIN      
        1 tctcatatca atgtacaaaa tgaaatacta tatcattgcc gttttagtaa ctttagtcat
       61 tctagccggg gtatgtgctt ccgatgatga ctcttgcaca attgatggtc atgtggttaa
      121 gaaaggcgaa tattatcatc caataggcaa atgtgaacgt gtgcactgtc gtggcagcga
      181 ccacatatct ggtattggat gtggtgttgt agctatacgt cctggtagta aatgtaaact
      241 tattcccaaa gatctaacca aaccttatcc ccactgttgt gaatcctatg agtgctaa