Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366694 298 bp mRNA linear INV 02-SEP-2023 transcript variant X2, mRNA. ACCESSION XM_059366694 VERSION XM_059366694.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..298 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..298 /gene="LOC131996780" /note="la1-like protein 13; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131996780" CDS 11..298 /gene="LOC131996780" /codon_start=1 /product="la1-like protein 13 isoform X2" /protein_id="XP_059222677.1" /db_xref="GeneID:131996780" /translation="MYKMKYYIIAVLVTLVILAGVCASDDDSCTIDGHVVKKGEYYHP IGKCERVHCRGSDHISGIGCGVVAIRPGSKCKLIPKDLTKPYPHCCESYEC" ORIGIN 1 tctcatatca atgtacaaaa tgaaatacta tatcattgcc gttttagtaa ctttagtcat 61 tctagccggg gtatgtgctt ccgatgatga ctcttgcaca attgatggtc atgtggttaa 121 gaaaggcgaa tattatcatc caataggcaa atgtgaacgt gtgcactgtc gtggcagcga 181 ccacatatct ggtattggat gtggtgttgt agctatacgt cctggtagta aatgtaaact 241 tattcccaaa gatctaacca aaccttatcc ccactgttgt gaatcctatg agtgctaa