Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366691 884 bp mRNA linear INV 02-SEP-2023 (LOC131996777), mRNA. ACCESSION XM_059366691 VERSION XM_059366691.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..884 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..884 /gene="LOC131996777" /note="uncharacterized LOC131996777; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996777" CDS 11..505 /gene="LOC131996777" /codon_start=1 /product="uncharacterized protein LOC131996777" /protein_id="XP_059222674.1" /db_xref="GeneID:131996777" /translation="MEANIIQQKEKKMGSKQMNLNKIYECAICLERHSLRYCRIFCGM TVADRRVTVRNHKYCMNCLARSHEVEDCHSAATCRKCGYQHHTMLHPQIPVPPTALTP AYVSPKVANRYTKKATTEATPRRKKLRTRSQRPEIKPSELLQKQLLAEALKCVATVIC EDVA" polyA_site 884 /gene="LOC131996777" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcgttgtgc atggaggcta atataataca acaaaaagaa aaaaaaatgg gctcaaagca 61 aatgaatctc aacaagattt atgagtgcgc catctgtttg gagaggcact cgctccgcta 121 ctgccgaatc ttctgcggca tgacggtggc agataggagg gtgaccgtcc gtaaccacaa 181 atattgtatg aactgcctgg cccggagtca cgaggtggag gactgccact cagccgccac 241 ctgtcgaaaa tgcggctacc agcaccatac gatgctgcac ccacaaattc cggtgcctcc 301 taccgccctc acaccagcat atgtaagccc caaagttgcc aaccgctaca cgaagaaagc 361 gacgactgaa gccaccccca gacgcaagaa gttgaggaca agaagccaac gaccagaaat 421 caagccgtct gagctgctgc agaaacagct gctcgctgag gcgctgaaat gtgtggcaac 481 agttatctgc gaagatgttg cgtagatgca aggccggcgg catggacaat cctgtcctta 541 acatttgatt ttatattttg ttttttgttt tgaatacttg aatttaattg taccattgaa 601 ttataattga attaaattgt taaattgtac ttcccaactc tgattgtaat agaatgctaa 661 aaggcatgtc agtttgtact aaaggaatga tatggaatta gaacattcct gactacatgc 721 cctttttaga aacttaccat caaacacttg gtcatcagcg ttcgatcggt aaggtttgaa 781 gattctaact cctcttttca tctctttccc tagcgtaaca tctacctaac ccactaaccc 841 tatttaaata aacttacata ttataacgtt ttactgaaac caaa