Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996777


LOCUS       XM_059366691             884 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996777), mRNA.
ACCESSION   XM_059366691
VERSION     XM_059366691.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..884
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..884
                     /gene="LOC131996777"
                     /note="uncharacterized LOC131996777; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996777"
     CDS             11..505
                     /gene="LOC131996777"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996777"
                     /protein_id="XP_059222674.1"
                     /db_xref="GeneID:131996777"
                     /translation="MEANIIQQKEKKMGSKQMNLNKIYECAICLERHSLRYCRIFCGM
                     TVADRRVTVRNHKYCMNCLARSHEVEDCHSAATCRKCGYQHHTMLHPQIPVPPTALTP
                     AYVSPKVANRYTKKATTEATPRRKKLRTRSQRPEIKPSELLQKQLLAEALKCVATVIC
                     EDVA"
     polyA_site      884
                     /gene="LOC131996777"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcgttgtgc atggaggcta atataataca acaaaaagaa aaaaaaatgg gctcaaagca
       61 aatgaatctc aacaagattt atgagtgcgc catctgtttg gagaggcact cgctccgcta
      121 ctgccgaatc ttctgcggca tgacggtggc agataggagg gtgaccgtcc gtaaccacaa
      181 atattgtatg aactgcctgg cccggagtca cgaggtggag gactgccact cagccgccac
      241 ctgtcgaaaa tgcggctacc agcaccatac gatgctgcac ccacaaattc cggtgcctcc
      301 taccgccctc acaccagcat atgtaagccc caaagttgcc aaccgctaca cgaagaaagc
      361 gacgactgaa gccaccccca gacgcaagaa gttgaggaca agaagccaac gaccagaaat
      421 caagccgtct gagctgctgc agaaacagct gctcgctgag gcgctgaaat gtgtggcaac
      481 agttatctgc gaagatgttg cgtagatgca aggccggcgg catggacaat cctgtcctta
      541 acatttgatt ttatattttg ttttttgttt tgaatacttg aatttaattg taccattgaa
      601 ttataattga attaaattgt taaattgtac ttcccaactc tgattgtaat agaatgctaa
      661 aaggcatgtc agtttgtact aaaggaatga tatggaatta gaacattcct gactacatgc
      721 cctttttaga aacttaccat caaacacttg gtcatcagcg ttcgatcggt aaggtttgaa
      781 gattctaact cctcttttca tctctttccc tagcgtaaca tctacctaac ccactaaccc
      841 tatttaaata aacttacata ttataacgtt ttactgaaac caaa