Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans V-type proton ATPase 16 kDa


LOCUS       XM_059366678             674 bp    mRNA    linear   INV 02-SEP-2023
            proteolipid subunit c (LOC131996769), mRNA.
ACCESSION   XM_059366678
VERSION     XM_059366678.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..674
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..674
                     /gene="LOC131996769"
                     /note="V-type proton ATPase 16 kDa proteolipid subunit c;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 42 Proteins"
                     /db_xref="GeneID:131996769"
     CDS             102..578
                     /gene="LOC131996769"
                     /codon_start=1
                     /product="V-type proton ATPase 16 kDa proteolipid subunit
                     c"
                     /protein_id="XP_059222661.1"
                     /db_xref="GeneID:131996769"
                     /translation="MADSGSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAA
                     MSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYTLYKGFIHLGAGLAV
                     GFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK"
     polyA_site      674
                     /gene="LOC131996769"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgcaagcaa ccgtcaaaga gaacactagc aggcagcaag gcaattgtgt ttttagctgc
       61 taataaaaaa aaacctctta atttaaaaca catcaacaaa aatggcagat tcaggaagcg
      121 ataatcctat ctatggaccc ttcttcggtg ttatgggagc cgcctcagcc atcattttca
      181 gtgctttggg agcagcctat ggaacagcta aatcaggtac tggtatcgcg gctatgtccg
      241 tcatgagacc agaattgatt atgaaatcca tcattcccgt tgtcatggct ggtattattg
      301 ccatttacgg tttggtcgta gctgtcctca ttgctggtgc tctggaagaa ccctcaaaat
      361 acacccttta caagggtttc atccatttgg gtgccggttt ggctgtaggt ttctcaggct
      421 tagcggcagg ttttgcgatc ggtattgttg gtgatgccgg tgtcagaggt acagctcaac
      481 aacctcgtct cttcgtcggt atgattttga ttcttatttt cgctgaagta ttgggtctgt
      541 acggtctcat tgttgccatt tacttgtaca ccaaataaat taatcaacac agcaacaata
      601 acaataagaa aaacaaccac aacaataaca aaaaacaacc atcaagaaaa caatcatctt
      661 cttcaatgtc aata