Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366678 674 bp mRNA linear INV 02-SEP-2023 proteolipid subunit c (LOC131996769), mRNA. ACCESSION XM_059366678 VERSION XM_059366678.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..674 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..674 /gene="LOC131996769" /note="V-type proton ATPase 16 kDa proteolipid subunit c; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 42 Proteins" /db_xref="GeneID:131996769" CDS 102..578 /gene="LOC131996769" /codon_start=1 /product="V-type proton ATPase 16 kDa proteolipid subunit c" /protein_id="XP_059222661.1" /db_xref="GeneID:131996769" /translation="MADSGSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAA MSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYTLYKGFIHLGAGLAV GFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK" polyA_site 674 /gene="LOC131996769" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgcaagcaa ccgtcaaaga gaacactagc aggcagcaag gcaattgtgt ttttagctgc 61 taataaaaaa aaacctctta atttaaaaca catcaacaaa aatggcagat tcaggaagcg 121 ataatcctat ctatggaccc ttcttcggtg ttatgggagc cgcctcagcc atcattttca 181 gtgctttggg agcagcctat ggaacagcta aatcaggtac tggtatcgcg gctatgtccg 241 tcatgagacc agaattgatt atgaaatcca tcattcccgt tgtcatggct ggtattattg 301 ccatttacgg tttggtcgta gctgtcctca ttgctggtgc tctggaagaa ccctcaaaat 361 acacccttta caagggtttc atccatttgg gtgccggttt ggctgtaggt ttctcaggct 421 tagcggcagg ttttgcgatc ggtattgttg gtgatgccgg tgtcagaggt acagctcaac 481 aacctcgtct cttcgtcggt atgattttga ttcttatttt cgctgaagta ttgggtctgt 541 acggtctcat tgttgccatt tacttgtaca ccaaataaat taatcaacac agcaacaata 601 acaataagaa aaacaaccac aacaataaca aaaaacaacc atcaagaaaa caatcatctt 661 cttcaatgtc aata