Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366614 448 bp mRNA linear INV 02-SEP-2023 (LOC131996748), mRNA. ACCESSION XM_059366614 VERSION XM_059366614.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..448 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..448 /gene="LOC131996748" /note="cytochrome P450 4d8-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 Proteins" /db_xref="GeneID:131996748" CDS 13..411 /gene="LOC131996748" /codon_start=1 /product="cytochrome P450 4d8-like" /protein_id="XP_059222597.1" /db_xref="GeneID:131996748" /translation="MINIQLKIVHNKKNINFEKITCTSRDNQCIPKGTSLLLGIMTMQ NDAEYFPEPHRFIPERNEVPQNNFVFVPFSAGPRNCIGQRFAMLEMKAFLARTMQFYE LLPLGEDVEPTISVVLKSKNGWQMGFRKRH" polyA_site 448 /gene="LOC131996748" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccttgcataa caatgataaa catacaatta aaaatcgttc acaataagaa aaatataaat 61 tttgagaaaa ttacctgtac cagtagagac aatcaatgca ttcctaaagg aaccagcctt 121 ctattgggta taatgacaat gcaaaatgat gctgaatatt ttccggaacc ccacagattt 181 ataccggaaa gaaacgaggt tccccaaaat aactttgttt tcgttccttt cagtgctggc 241 ccgagaaatt gtattggaca acgttttgct atgttagaaa tgaaagcttt cctagctaga 301 accatgcaat tctatgaact attgcctttg ggcgaagatg tcgaaccaac cataagcgtg 361 gtattgaaat ctaaaaatgg atggcaaatg ggatttagaa aaaggcacta aatttacaca 421 ataaaatgat ttgatttcaa ttaactaa