Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome P450 4d8-like


LOCUS       XM_059366614             448 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996748), mRNA.
ACCESSION   XM_059366614
VERSION     XM_059366614.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..448
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..448
                     /gene="LOC131996748"
                     /note="cytochrome P450 4d8-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 17
                     Proteins"
                     /db_xref="GeneID:131996748"
     CDS             13..411
                     /gene="LOC131996748"
                     /codon_start=1
                     /product="cytochrome P450 4d8-like"
                     /protein_id="XP_059222597.1"
                     /db_xref="GeneID:131996748"
                     /translation="MINIQLKIVHNKKNINFEKITCTSRDNQCIPKGTSLLLGIMTMQ
                     NDAEYFPEPHRFIPERNEVPQNNFVFVPFSAGPRNCIGQRFAMLEMKAFLARTMQFYE
                     LLPLGEDVEPTISVVLKSKNGWQMGFRKRH"
     polyA_site      448
                     /gene="LOC131996748"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccttgcataa caatgataaa catacaatta aaaatcgttc acaataagaa aaatataaat
       61 tttgagaaaa ttacctgtac cagtagagac aatcaatgca ttcctaaagg aaccagcctt
      121 ctattgggta taatgacaat gcaaaatgat gctgaatatt ttccggaacc ccacagattt
      181 ataccggaaa gaaacgaggt tccccaaaat aactttgttt tcgttccttt cagtgctggc
      241 ccgagaaatt gtattggaca acgttttgct atgttagaaa tgaaagcttt cctagctaga
      301 accatgcaat tctatgaact attgcctttg ggcgaagatg tcgaaccaac cataagcgtg
      361 gtattgaaat ctaaaaatgg atggcaaatg ggatttagaa aaaggcacta aatttacaca
      421 ataaaatgat ttgatttcaa ttaactaa