Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996746


LOCUS       XM_059366607             732 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996746), mRNA.
ACCESSION   XM_059366607
VERSION     XM_059366607.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..732
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..732
                     /gene="LOC131996746"
                     /note="uncharacterized LOC131996746; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996746"
     CDS             1..585
                     /gene="LOC131996746"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996746"
                     /protein_id="XP_059222590.1"
                     /db_xref="GeneID:131996746"
                     /translation="MSKCHLHLIFGVILLQLSINLIQANDTNYDLSMVHDFIEAIAKQ
                     RRVILCMVQSCDALALEKIYQIEEAVERELKQQPTFSETHEFESLKLDKAINRAVDTM
                     LALEPNCKDVTYVCPTQAQIPKYINEYTSGLADIITNSKCINSGNIKDAVDILGKSVE
                     YVEQYHNHSGNFMQRVHPAAVYVANEFAKLCDRI"
ORIGIN      
        1 atgtctaaat gccatcttca tttgatattc ggagtcatac tactgcaact ttctataaat
       61 ctgatacagg ctaatgacac taattatgat cttagcatgg tgcatgattt cattgaagcc
      121 atagccaaac aacgccgtgt aatactgtgt atggtccaaa gttgtgatgc actagccctg
      181 gaaaaaatat atcaaattga ggaggctgtt gaacgagaac ttaaacaaca acccactttc
      241 tctgagaccc atgaatttga atcgctaaaa ttggataagg ctataaatag ggctgtagac
      301 acaatgctag ctctcgaacc caattgcaag gatgtcacct atgtctgtcc cactcaagca
      361 caaatcccaa aatatatcaa cgaatatact tcaggattgg cggatataat cacaaatagc
      421 aagtgcatca atagcgggaa tattaaagat gccgttgaca ttttgggcaa gagtgtagaa
      481 tatgtcgaac aatatcataa tcattcgggc aattttatgc aaagagttca tcccgctgcc
      541 gtttatgtgg ccaatgagtt tgccaaattg tgtgatagaa tctaaaatgg agcgccatat
      601 taaacctaac attgctgcgt tcaagggttt ctcattcggt gtcccttttt tgatatttaa
      661 gcaatatgaa attttttagt accatagtca tatatattgg gttgcccaaa aagtagttgc
      721 ggatttttta aa