Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366607 732 bp mRNA linear INV 02-SEP-2023 (LOC131996746), mRNA. ACCESSION XM_059366607 VERSION XM_059366607.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..732 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..732 /gene="LOC131996746" /note="uncharacterized LOC131996746; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996746" CDS 1..585 /gene="LOC131996746" /codon_start=1 /product="uncharacterized protein LOC131996746" /protein_id="XP_059222590.1" /db_xref="GeneID:131996746" /translation="MSKCHLHLIFGVILLQLSINLIQANDTNYDLSMVHDFIEAIAKQ RRVILCMVQSCDALALEKIYQIEEAVERELKQQPTFSETHEFESLKLDKAINRAVDTM LALEPNCKDVTYVCPTQAQIPKYINEYTSGLADIITNSKCINSGNIKDAVDILGKSVE YVEQYHNHSGNFMQRVHPAAVYVANEFAKLCDRI" ORIGIN 1 atgtctaaat gccatcttca tttgatattc ggagtcatac tactgcaact ttctataaat 61 ctgatacagg ctaatgacac taattatgat cttagcatgg tgcatgattt cattgaagcc 121 atagccaaac aacgccgtgt aatactgtgt atggtccaaa gttgtgatgc actagccctg 181 gaaaaaatat atcaaattga ggaggctgtt gaacgagaac ttaaacaaca acccactttc 241 tctgagaccc atgaatttga atcgctaaaa ttggataagg ctataaatag ggctgtagac 301 acaatgctag ctctcgaacc caattgcaag gatgtcacct atgtctgtcc cactcaagca 361 caaatcccaa aatatatcaa cgaatatact tcaggattgg cggatataat cacaaatagc 421 aagtgcatca atagcgggaa tattaaagat gccgttgaca ttttgggcaa gagtgtagaa 481 tatgtcgaac aatatcataa tcattcgggc aattttatgc aaagagttca tcccgctgcc 541 gtttatgtgg ccaatgagtt tgccaaattg tgtgatagaa tctaaaatgg agcgccatat 601 taaacctaac attgctgcgt tcaagggttt ctcattcggt gtcccttttt tgatatttaa 661 gcaatatgaa attttttagt accatagtca tatatattgg gttgcccaaa aagtagttgc 721 ggatttttta aa