Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996745


LOCUS       XM_059366606             948 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996745), mRNA.
ACCESSION   XM_059366606
VERSION     XM_059366606.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..948
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..948
                     /gene="LOC131996745"
                     /note="uncharacterized LOC131996745; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996745"
     CDS             152..739
                     /gene="LOC131996745"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996745"
                     /protein_id="XP_059222589.1"
                     /db_xref="GeneID:131996745"
                     /translation="MSKLNIALFFCVLLVTVVNPTQAVDQKTDESLLKEFLDAFVNHV
                     HTIRCLANSCDPLAINKVFDATNLEEDILSSQRDNVETDEFKTLKLSKAIEFATMNML
                     MMEPKCNDPTFVCPYRVFNEIPQSIVDYTTKLETMIENTKCIPPNRVQEAIDILGKCI
                     TYAEQFTDHKADYLKRVIPPIEYSIIEFGKLCAQA"
     polyA_site      948
                     /gene="LOC131996745"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgttttca taaaaagtaa atgttagcag agctttttat ataaaatcag ttgtgtacac
       61 aatgaaatga tttaaatttt tactataaaa gccaaacttg aaatctagag attacagata
      121 ttaaagagac gatactgaga tacgattcaa tatgtctaag cttaacattg cattgttttt
      181 ctgtgttctt ctagtaactg ttgtgaaccc cacacaggct gttgatcaaa aaaccgatga
      241 aagcctactt aaggaattcc tcgatgcatt tgtcaatcat gtgcatacca tacgctgtct
      301 agctaatagt tgtgatcccc tggccatcaa taaggtcttc gatgccacga acctagagga
      361 ggatatcctg agtagccaaa gggacaatgt cgagaccgat gaatttaaga ctcttaagtt
      421 gtccaaagcc attgaatttg ccacaatgaa catgttgatg atggagccca aatgcaacga
      481 tcccactttt gtttgtcctt atagagtatt taacgaaatt ccacaatcca tcgttgacta
      541 tacaactaaa ttggagacta tgatcgaaaa caccaaatgc attcccccca accgtgttca
      601 ggaagccatc gatattctgg gtaaatgtat tacatatgcc gagcaattta cagatcataa
      661 ggctgactac ctgaagagag taatcccacc aattgagtat agcattatcg aatttggtaa
      721 attgtgtgca caagcttgaa taagctaagg catttttttt tttttaatta gaaatgttat
      781 gttataaaaa tatgtaatat accaagaata atgttattta cattaaaacc agttaagcta
      841 ttgtcccgct gctgaccgta gggttctcag ggttagtgca aaaagtgtgt tacttcttaa
      901 ataaaaaaaa atgttacttc ttaaataaaa ataaagtcag aaccacga