Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366606 948 bp mRNA linear INV 02-SEP-2023 (LOC131996745), mRNA. ACCESSION XM_059366606 VERSION XM_059366606.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..948 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..948 /gene="LOC131996745" /note="uncharacterized LOC131996745; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996745" CDS 152..739 /gene="LOC131996745" /codon_start=1 /product="uncharacterized protein LOC131996745" /protein_id="XP_059222589.1" /db_xref="GeneID:131996745" /translation="MSKLNIALFFCVLLVTVVNPTQAVDQKTDESLLKEFLDAFVNHV HTIRCLANSCDPLAINKVFDATNLEEDILSSQRDNVETDEFKTLKLSKAIEFATMNML MMEPKCNDPTFVCPYRVFNEIPQSIVDYTTKLETMIENTKCIPPNRVQEAIDILGKCI TYAEQFTDHKADYLKRVIPPIEYSIIEFGKLCAQA" polyA_site 948 /gene="LOC131996745" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgttttca taaaaagtaa atgttagcag agctttttat ataaaatcag ttgtgtacac 61 aatgaaatga tttaaatttt tactataaaa gccaaacttg aaatctagag attacagata 121 ttaaagagac gatactgaga tacgattcaa tatgtctaag cttaacattg cattgttttt 181 ctgtgttctt ctagtaactg ttgtgaaccc cacacaggct gttgatcaaa aaaccgatga 241 aagcctactt aaggaattcc tcgatgcatt tgtcaatcat gtgcatacca tacgctgtct 301 agctaatagt tgtgatcccc tggccatcaa taaggtcttc gatgccacga acctagagga 361 ggatatcctg agtagccaaa gggacaatgt cgagaccgat gaatttaaga ctcttaagtt 421 gtccaaagcc attgaatttg ccacaatgaa catgttgatg atggagccca aatgcaacga 481 tcccactttt gtttgtcctt atagagtatt taacgaaatt ccacaatcca tcgttgacta 541 tacaactaaa ttggagacta tgatcgaaaa caccaaatgc attcccccca accgtgttca 601 ggaagccatc gatattctgg gtaaatgtat tacatatgcc gagcaattta cagatcataa 661 ggctgactac ctgaagagag taatcccacc aattgagtat agcattatcg aatttggtaa 721 attgtgtgca caagcttgaa taagctaagg catttttttt tttttaatta gaaatgttat 781 gttataaaaa tatgtaatat accaagaata atgttattta cattaaaacc agttaagcta 841 ttgtcccgct gctgaccgta gggttctcag ggttagtgca aaaagtgtgt tacttcttaa 901 ataaaaaaaa atgttacttc ttaaataaaa ataaagtcag aaccacga