PREDICTED: Stomoxys calcitrans uncharacterized LOC106084284

LOCUS       XM_059366540             444 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084284), mRNA.
ACCESSION   XM_059366540
VERSION     XM_059366540.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..444
                     /gene="LOC106084284"
                     /note="uncharacterized LOC106084284; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084284"
     CDS             1..444
                     /gene="LOC106084284"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084284"
                     /protein_id="XP_059222523.1"
                     /db_xref="GeneID:106084284"
                     /translation="MLRFAILLISALVLCEAHVGSRQQEWCLGDFAKGVLNMCAEKNN
                     VGKAAIEDFLKGKLSNNKNERCFRACFLMECEYFEGYGGFKSDTQLRLATQFALRYPS
                     KYKVAKKIVGSCMFALSEPNVCDTAEELFKCIKLNSPFPLTLQGI"
ORIGIN      
        1 atgctacggt ttgccatatt attaatttct gcacttgtgc tgtgtgaagc tcatgttggc
       61 agtcgtcagc aagaatggtg tttgggcgac tttgctaaag gtgttttgaa tatgtgtgcg
      121 gaaaaaaaca atgtgggaaa ggctgcaatt gaagatttct taaagggaaa actttcaaac
      181 aacaaaaatg aaagatgttt ccgagcatgc tttttaatgg aatgtgaata ttttgaaggt
      241 tatggtggtt tcaaatctga tacacaacta agactggcga ctcaatttgc cctacgttac
      301 ccttctaaat acaaggtggc gaagaagata gtgggtagct gcatgtttgc cttgtcagaa
      361 ccaaatgttt gtgataccgc tgaggaatta ttcaaatgta taaaattgaa ctccccattt
      421 cccttgactc tccaaggcat ttaa