PREDICTED: Stomoxys calcitrans ctenidin-1-like (LOC131996724),

LOCUS       XM_059366529             345 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_059366529
VERSION     XM_059366529.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..345
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..345
                     /gene="LOC131996724"
                     /note="ctenidin-1-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 7 Proteins"
                     /db_xref="GeneID:131996724"
     CDS             1..345
                     /gene="LOC131996724"
                     /codon_start=1
                     /product="ctenidin-1-like"
                     /protein_id="XP_059222512.1"
                     /db_xref="GeneID:131996724"
                     /translation="MGKFFIVGILVVFSALCVCNAQYRGGGGGGLYGGGGGGGGSLGG
                     GGGGGGPIGGGGGGPFGGGGGGGGSYGGGGGGGPFGGGGGGNYGGGGGGRYGVGGGRG
                     YNGGRKRVSPRL"
ORIGIN      
        1 atgggcaaat ttttcattgt tggcatttta gttgtattca gtgctttgtg tgtgtgtaat
       61 gcccaatatc gaggaggtgg tggtggaggt ctatatggcg gtgggggtgg tggaggtggt
      121 tctctaggag gcggaggtgg cggtggaggt cctataggcg gtggtggcgg cggacccttt
      181 ggaggaggtg gtggtggcgg aggatcctat ggaggaggtg gtggcggcgg cccttttggt
      241 ggtggaggtg gtggtaacta tggaggcggt ggtggaggac gctatggagt cggtggtggc
      301 agaggatata atggcggcag aaaaagagtc agccctcggc tctag