PREDICTED: Stomoxys calcitrans uncharacterized LOC131996721

LOCUS       XM_059366527             261 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996721), mRNA.
ACCESSION   XM_059366527
VERSION     XM_059366527.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..261
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..261
                     /gene="LOC131996721"
                     /note="uncharacterized LOC131996721; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996721"
     CDS             1..261
                     /gene="LOC131996721"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996721"
                     /protein_id="XP_059222510.1"
                     /db_xref="GeneID:131996721"
                     /translation="MVTMKVFLLLGFLLICGAIGILGKPQYYGGGGGDGGGGSGNGGY
                     GYGGIGPNGPYGGSGGNGGFGYASSDGTRGSGSSGNGYGYSY"
ORIGIN      
        1 atggtgacta tgaaggtgtt cctattgctt ggatttttgc tgatttgcgg tgccattggt
       61 attctaggaa aaccccaata ttatggtggc ggaggaggag acggtggtgg tggcagtggt
      121 aatggtggtt atggctacgg tggtatagga cccaatggtc cctatggcgg ttcaggtgga
      181 aatggaggct ttggttatgc ctcttctgat ggaactcgtg gcagcggttc cagtggcaat
      241 ggctatggtt attcatatta a