PREDICTED: Stomoxys calcitrans uncharacterized LOC131996715

LOCUS       XM_059366508             797 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996715), mRNA.
ACCESSION   XM_059366508
VERSION     XM_059366508.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 35% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..797
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..797
                     /gene="LOC131996715"
                     /note="uncharacterized LOC131996715; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:131996715"
     CDS             207..797
                     /gene="LOC131996715"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996715"
                     /protein_id="XP_059222491.1"
                     /db_xref="GeneID:131996715"
                     /translation="MNNSKTIKKTTPKQFEALVDFMCQNPNIAKGYHKNTDKLSIKEQ
                     WNNLQRKLNSLGPPTREAEGWMKVWADMKSSVKKKIVHNKMESRATGGGIFNQKLLTP
                     LEEAVAGLLQINSIVSPECPSIGVQSSPVNLIQEILEDEVDGHVSEDNVEVDIQPNTS
                     TRKRKQRTVDKNVLLDQQLIIKIKIISIGFVFFVRR"
ORIGIN      
        1 tagtcacaac gaattcctgt cgtttattgt gaatggtatt acatatgtcg tttttcgcct
       61 gaaatgcgac tatgtttaaa atctattaca ttttttggta ttatgtatgc cgttttttaa
      121 cgagaaattc gacagaaaca gtcgtagaga atttttcaag tgacaagatt aaaaattaca
      181 aaaactgaat aaaaataatt agaaaaatga ataacagcaa aacgataaag aaaacgacac
      241 caaaacaatt tgaagctctt gtggatttta tgtgtcaaaa cccaaatata gctaaaggat
      301 accataaaaa cacagacaag ttgtccatta aagagcagtg gaataatttg caaaggaagc
      361 tgaatagttt aggccctccc acacgtgagg ctgaaggttg gatgaaggta tgggcagata
      421 tgaagagcag cgttaagaag aaaatcgtgc acaataagat ggaaagccgt gcaactggtg
      481 gaggcatttt caaccagaag ttgttgacac ctttggagga ggcagtagca ggactactgc
      541 aaatcaattc tattgtaagt ccagaatgcc catccatcgg tgttcaaagc tcaccggtaa
      601 acctgattca agaaattttg gaggacgaag ttgatggaca cgtcagcgag gacaatgtag
      661 aagtggatat ccaacccaat acttccactc gaaaaaggaa gcaacgaact gtggacaaaa
      721 atgtacttct ggatcaacag cttataatta agattaagat tataagcatt ggtttcgtct
      781 tcttcgtcag aagatga