Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366507 678 bp mRNA linear INV 02-SEP-2023 PPE24-like (LOC131996714), mRNA. ACCESSION XM_059366507 VERSION XM_059366507.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..678 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..678 /gene="LOC131996714" /note="uncharacterized PPE family protein PPE24-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996714" CDS 1..678 /gene="LOC131996714" /codon_start=1 /product="uncharacterized PPE family protein PPE24-like" /protein_id="XP_059222490.1" /db_xref="GeneID:131996714" /translation="MALPGMALPGMALPGMALPGMTLPGMALPGMTLPGMALPGMTLP GMTLPGMTLPGMALPGVALPGMALPGMALPGMALPGMALPGMALPGMALPGMALPGMT LPGMTLPGMTLPGMTLPGMALPGVALPGMALPGMALPGMALPGMALPGMALPGMALPG MALPGMALPGMALPGMALPGMALPGDFKGDARSTTMRLLSIHMQTPKVHTLTFAKGLS SMTGMSA" ORIGIN 1 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt 61 atgactctgc caggtatggc tctgccaggt atgactctgc caggtatggc tctgccaggt 121 atgactctgc caggtatgac tctgccaggt atgactctgc caggtatggc tctgccaggt 181 gtggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt 241 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt 301 atgactctgc caggtatgac tctgccaggt atgactctgc caggtatgac tctgccaggt 361 atggctctgc caggtgtggc tctgccaggt atggctctgc caggtatggc tctgccaggt 421 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt 481 atggctctgc caggtatggc tctgccagga atggctctgc caggaatggc tctgccaggt 541 atggctctgc caggagattt caagggggat gcccgctcaa caaccatgcg gctcttgagc 601 atacacatgc agacgccgaa agtacataca cttacatttg ccaagggctt gagtagcatg 661 actggcatga gtgcctag