Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized PPE family protein


LOCUS       XM_059366507             678 bp    mRNA    linear   INV 02-SEP-2023
            PPE24-like (LOC131996714), mRNA.
ACCESSION   XM_059366507
VERSION     XM_059366507.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..678
                     /gene="LOC131996714"
                     /note="uncharacterized PPE family protein PPE24-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:131996714"
     CDS             1..678
                     /gene="LOC131996714"
                     /codon_start=1
                     /product="uncharacterized PPE family protein PPE24-like"
                     /protein_id="XP_059222490.1"
                     /db_xref="GeneID:131996714"
                     /translation="MALPGMALPGMALPGMALPGMTLPGMALPGMTLPGMALPGMTLP
                     GMTLPGMTLPGMALPGVALPGMALPGMALPGMALPGMALPGMALPGMALPGMALPGMT
                     LPGMTLPGMTLPGMTLPGMALPGVALPGMALPGMALPGMALPGMALPGMALPGMALPG
                     MALPGMALPGMALPGMALPGMALPGDFKGDARSTTMRLLSIHMQTPKVHTLTFAKGLS
                     SMTGMSA"
ORIGIN      
        1 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt
       61 atgactctgc caggtatggc tctgccaggt atgactctgc caggtatggc tctgccaggt
      121 atgactctgc caggtatgac tctgccaggt atgactctgc caggtatggc tctgccaggt
      181 gtggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt
      241 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt
      301 atgactctgc caggtatgac tctgccaggt atgactctgc caggtatgac tctgccaggt
      361 atggctctgc caggtgtggc tctgccaggt atggctctgc caggtatggc tctgccaggt
      421 atggctctgc caggtatggc tctgccaggt atggctctgc caggtatggc tctgccaggt
      481 atggctctgc caggtatggc tctgccagga atggctctgc caggaatggc tctgccaggt
      541 atggctctgc caggagattt caagggggat gcccgctcaa caaccatgcg gctcttgagc
      601 atacacatgc agacgccgaa agtacataca cttacatttg ccaagggctt gagtagcatg
      661 actggcatga gtgcctag