Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366482 858 bp mRNA linear INV 02-SEP-2023 lipase-like (LOC106087426), partial mRNA. ACCESSION XM_059366482 VERSION XM_059366482.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 3% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..858 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene <1..858 /gene="LOC106087426" /note="pancreatic triacylglycerol lipase-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 28 Proteins" /db_xref="GeneID:106087426" CDS <1..858 /gene="LOC106087426" /codon_start=1 /product="pancreatic triacylglycerol lipase-like" /protein_id="XP_059222465.1" /db_xref="GeneID:106087426" /translation="VLSRSGSPNKFYLYTPDNPNTAQLLFTNNKDSVTNSHFEKSRPT RIIIHGWHSDYTSTPNIPIREAYLSEGDYNIISVDWNDYSKLNYITARANVPVVGDEV AQFIDFLNAEFDMSFSNLVVIGHSLGAHVAGYCGKSVTRGTLDAIVGLDPASALFCYG NSQTRLASTDAIYVQTIQTNGSCQGFLKPIGTASFYPNWGRKQPGCGFEPFGACSHHR CISYYVEAIKGNSFAPVYKCRNYNDIWNKKRGDLDASAQIGDPMQIKRVSGIFYFATN SHEPYGHRS" ORIGIN 1 gttctctcac gatccggatc acccaataaa ttctatctgt atacacctga caatcccaac 61 acagcccagt tattgtttac aaacaataag gattctgtaa caaactcgca ttttgagaaa 121 tccagaccca ccagaattat tatccatggc tggcatagcg actatacttc tacacccaat 181 atacccatac gtgaggctta tctttcagaa ggtgattaca acatcatttc ggttgattgg 241 aatgactatt caaaattaaa ttacattacg gctcgcgcca atgttccggt agtgggcgat 301 gaggtggccc aatttataga ctttctcaat gcggagtttg acatgagctt tagcaacttg 361 gtggttatag gccatagttt aggcgcccat gttgctggtt attgtggcaa gagtgtgacc 421 agaggtaccc tggatgctat tgtgggcctg gatcctgcct ccgccttgtt ctgctatgga 481 aattcccaaa cccgtttggc cagcaccgat gccatatatg tgcagactat acagaccaat 541 ggaagttgcc aagggttcct aaagcccatt ggtacagcct cattctatcc gaattggggc 601 cgaaaacaac ccggctgtgg ctttgaacct tttggtgcct gctcccacca tcgttgcatc 661 agctattatg ttgaggccat taagggcaac tcatttgcgc ccgtctacaa gtgtaggaat 721 tacaacgata tttggaataa gaagagaggt gacttggatg ctagtgctca aattggtgat 781 cccatgcaaa ttaaacgtgt ctctggtatt ttctattttg ccacaaacag tcatgaaccc 841 tatggtcatc gttcataa