Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans pancreatic triacylglycerol


LOCUS       XM_059366482             858 bp    mRNA    linear   INV 02-SEP-2023
            lipase-like (LOC106087426), partial mRNA.
ACCESSION   XM_059366482
VERSION     XM_059366482.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..858
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..858
                     /gene="LOC106087426"
                     /note="pancreatic triacylglycerol lipase-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 28 Proteins"
                     /db_xref="GeneID:106087426"
     CDS             <1..858
                     /gene="LOC106087426"
                     /codon_start=1
                     /product="pancreatic triacylglycerol lipase-like"
                     /protein_id="XP_059222465.1"
                     /db_xref="GeneID:106087426"
                     /translation="VLSRSGSPNKFYLYTPDNPNTAQLLFTNNKDSVTNSHFEKSRPT
                     RIIIHGWHSDYTSTPNIPIREAYLSEGDYNIISVDWNDYSKLNYITARANVPVVGDEV
                     AQFIDFLNAEFDMSFSNLVVIGHSLGAHVAGYCGKSVTRGTLDAIVGLDPASALFCYG
                     NSQTRLASTDAIYVQTIQTNGSCQGFLKPIGTASFYPNWGRKQPGCGFEPFGACSHHR
                     CISYYVEAIKGNSFAPVYKCRNYNDIWNKKRGDLDASAQIGDPMQIKRVSGIFYFATN
                     SHEPYGHRS"
ORIGIN      
        1 gttctctcac gatccggatc acccaataaa ttctatctgt atacacctga caatcccaac
       61 acagcccagt tattgtttac aaacaataag gattctgtaa caaactcgca ttttgagaaa
      121 tccagaccca ccagaattat tatccatggc tggcatagcg actatacttc tacacccaat
      181 atacccatac gtgaggctta tctttcagaa ggtgattaca acatcatttc ggttgattgg
      241 aatgactatt caaaattaaa ttacattacg gctcgcgcca atgttccggt agtgggcgat
      301 gaggtggccc aatttataga ctttctcaat gcggagtttg acatgagctt tagcaacttg
      361 gtggttatag gccatagttt aggcgcccat gttgctggtt attgtggcaa gagtgtgacc
      421 agaggtaccc tggatgctat tgtgggcctg gatcctgcct ccgccttgtt ctgctatgga
      481 aattcccaaa cccgtttggc cagcaccgat gccatatatg tgcagactat acagaccaat
      541 ggaagttgcc aagggttcct aaagcccatt ggtacagcct cattctatcc gaattggggc
      601 cgaaaacaac ccggctgtgg ctttgaacct tttggtgcct gctcccacca tcgttgcatc
      661 agctattatg ttgaggccat taagggcaac tcatttgcgc ccgtctacaa gtgtaggaat
      721 tacaacgata tttggaataa gaagagaggt gacttggatg ctagtgctca aattggtgat
      781 cccatgcaaa ttaaacgtgt ctctggtatt ttctattttg ccacaaacag tcatgaaccc
      841 tatggtcatc gttcataa