Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996707


LOCUS       XM_059366469            1006 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996707), mRNA.
ACCESSION   XM_059366469
VERSION     XM_059366469.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1006
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1006
                     /gene="LOC131996707"
                     /note="uncharacterized LOC131996707; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996707"
     CDS             74..766
                     /gene="LOC131996707"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996707"
                     /protein_id="XP_059222452.1"
                     /db_xref="GeneID:131996707"
                     /translation="MMVPKFSGNDGRNIEKWINSFESYTINMTDQEKYMCLRYLLVGT
                     AREFMENSNYKEYKELKRSLLDIFKRTVTQEEVDQKLRLRKLKPTEACIAYIVAMQTI
                     AAEGEINEQELVDIIIDGMEDKTNNISILYGSNSLQELIHGIDRYEKRRSKTVSTHKE
                     GRDNTKGIRCFNCSQFGHMKNTCNKPRRPPGSCFHCFQMGHFYKDCPKRMNVTAPIFC
                     SNDIVDTTQMPN"
ORIGIN      
        1 tcgaaaccaa attgaatctt tagaaaacgg tggaaaaaag gtttctacaa atatcaatta
       61 tgacgagctc tctatgatgg ttccgaaatt ttctgggaat gatggacgaa atattgaaaa
      121 atggataaac tcttttgaaa gctacactat aaatatgact gaccaagaaa aatatatgtg
      181 cttaagatat ttgctggttg gaactgcgcg agagttcatg gaaaattcaa attacaaaga
      241 atataaggag ttgaagagat cgctcttaga cattttcaag agaacggtaa cgcaagaaga
      301 agttgatcaa aaattgcgtt tgcgcaagtt gaagccaaca gaggcgtgta ttgcctatat
      361 agtagcaatg caaactattg cagcagaagg cgaaatcaac gagcaagaac tggttgacat
      421 tataatagac ggaatggaag ataaaaccaa caacatatcc attctatacg gatcaaactc
      481 attacaagaa ttgatacatg gaatagatag atacgagaaa cgcaggtcaa aaacagtcag
      541 tactcataaa gaaggccgtg acaatactaa aggcatacga tgtttcaatt gctctcaatt
      601 tggacatatg aagaacacct gcaataagcc tcgacgtcca ccgggatctt gtttccattg
      661 tttccaaatg ggacattttt acaaggattg tcctaaaagg atgaatgtta ctgctcccat
      721 attttgtagt aatgatattg tagacacaac acaaatgccc aattagtttg gttaagatgt
      781 ctttattacc gactggtgtg atacgttcga agaatttaat accaacttcg tatgttggag
      841 ttggcaattc ccctttgaaa atatatggaa atatttcttg tttaataaaa tttaaaaaat
      901 cgtctaaaca aatagaatta cttgttgttc cgaacgagag cattcatgtt ccaatgattc
      961 ttggacggaa ctttatgcat gcatttaatg taaaattact tcaagt