Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366469 1006 bp mRNA linear INV 02-SEP-2023 (LOC131996707), mRNA. ACCESSION XM_059366469 VERSION XM_059366469.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1006 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1006 /gene="LOC131996707" /note="uncharacterized LOC131996707; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996707" CDS 74..766 /gene="LOC131996707" /codon_start=1 /product="uncharacterized protein LOC131996707" /protein_id="XP_059222452.1" /db_xref="GeneID:131996707" /translation="MMVPKFSGNDGRNIEKWINSFESYTINMTDQEKYMCLRYLLVGT AREFMENSNYKEYKELKRSLLDIFKRTVTQEEVDQKLRLRKLKPTEACIAYIVAMQTI AAEGEINEQELVDIIIDGMEDKTNNISILYGSNSLQELIHGIDRYEKRRSKTVSTHKE GRDNTKGIRCFNCSQFGHMKNTCNKPRRPPGSCFHCFQMGHFYKDCPKRMNVTAPIFC SNDIVDTTQMPN" ORIGIN 1 tcgaaaccaa attgaatctt tagaaaacgg tggaaaaaag gtttctacaa atatcaatta 61 tgacgagctc tctatgatgg ttccgaaatt ttctgggaat gatggacgaa atattgaaaa 121 atggataaac tcttttgaaa gctacactat aaatatgact gaccaagaaa aatatatgtg 181 cttaagatat ttgctggttg gaactgcgcg agagttcatg gaaaattcaa attacaaaga 241 atataaggag ttgaagagat cgctcttaga cattttcaag agaacggtaa cgcaagaaga 301 agttgatcaa aaattgcgtt tgcgcaagtt gaagccaaca gaggcgtgta ttgcctatat 361 agtagcaatg caaactattg cagcagaagg cgaaatcaac gagcaagaac tggttgacat 421 tataatagac ggaatggaag ataaaaccaa caacatatcc attctatacg gatcaaactc 481 attacaagaa ttgatacatg gaatagatag atacgagaaa cgcaggtcaa aaacagtcag 541 tactcataaa gaaggccgtg acaatactaa aggcatacga tgtttcaatt gctctcaatt 601 tggacatatg aagaacacct gcaataagcc tcgacgtcca ccgggatctt gtttccattg 661 tttccaaatg ggacattttt acaaggattg tcctaaaagg atgaatgtta ctgctcccat 721 attttgtagt aatgatattg tagacacaac acaaatgccc aattagtttg gttaagatgt 781 ctttattacc gactggtgtg atacgttcga agaatttaat accaacttcg tatgttggag 841 ttggcaattc ccctttgaaa atatatggaa atatttcttg tttaataaaa tttaaaaaat 901 cgtctaaaca aatagaatta cttgttgttc cgaacgagag cattcatgtt ccaatgattc 961 ttggacggaa ctttatgcat gcatttaatg taaaattact tcaagt