Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366446 1024 bp mRNA linear INV 02-SEP-2023 (LOC131996700), mRNA. ACCESSION XM_059366446 VERSION XM_059366446.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 30% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1024 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1024 /gene="LOC131996700" /note="uncharacterized LOC131996700; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996700" CDS 1..1020 /gene="LOC131996700" /codon_start=1 /product="uncharacterized protein LOC131996700" /protein_id="XP_059222429.1" /db_xref="GeneID:131996700" /translation="MVIHNESLLLQTDMEFMIFLPSKNNNTNNKLSSTHTHTHICVAS AAHSYVLNTTTRLSNVRAKLRKCLQSLWQHRPGLCYVSFLACYAKGFECCGICKIKRK CSEEAVAFGISPLHARIKFMECILHISYRLSFKKWRTDSYTKIEMAANKAEIGKRLKL TLGINVDAVKQGMGTTNDGNTARRFFENPAKTADVIGIKEELIHRFKIILAAINCNAA VDTSKFHIYCMDTAKLFVDLYGWYYMPVTVHKILVHGSKIIAEAILPIGMLSEEAQEA RNKDYRAYRLHHSRRIGRVATNEDVMHNLLLSSDPFINRFRSKLQIKKLEYDNDVKKL LKDYA" polyA_site 1024 /gene="LOC131996700" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggtcattc ataacgaatc tttgctgctg cagacagaca tggagttcat gatatttttg 61 cccagcaaaa acaacaacac caacaacaag ctctcatcca ctcatacgca cacacacata 121 tgtgtggcct cagccgccca ctcgtatgtg ttaaacacga caacgaggct atccaatgtg 181 cgtgcaaagc tgcgtaaatg tttgcagagc ttatggcagc ataggccagg gctatgctat 241 gtctcctttc tcgcctgcta cgccaaagga tttgaatgtt gcggcatttg caagatcaag 301 cggaaatgtt cggaagaagc agttgcgttt ggtatttctc ccttgcatgc gagaatcaaa 361 tttatggagt gcattctgca catttcttac cgtctaagtt tcaaaaaatg gagaacagat 421 agttacacaa aaattgaaat ggcggcaaat aaagctgaaa ttgggaagag attaaagttg 481 acactgggca taaatgtgga cgcggtgaag caaggtatgg gcacaacaaa cgatggcaat 541 acggcaagaa ggtttttcga aaatccagcc aaaactgcag acgtaattgg aataaaagaa 601 gagttaatac atagatttaa aattattttg gccgcaataa attgtaatgc agcagtcgac 661 actagcaaat ttcatatata ttgcatggat actgccaagt tgtttgttga tctctatggc 721 tggtactaca tgcctgtaac tgtgcataag attctggtgc atggtagcaa aattatagca 781 gaagctattc tgccaatagg tatgctgtcc gaagaagctc aggaagcgag gaataaagat 841 tatagagcct atagattaca tcattcgcga agaattggac gtgtagccac taatgaagat 901 gtaatgcata accttttatt gtcttcagac ccatttataa atagatttcg ctcaaagctg 961 caaatcaaaa aattggagta cgataatgat gttaaaaaat tattaaaaga ctatgcttaa 1021 ttta