Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996700


LOCUS       XM_059366446            1024 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996700), mRNA.
ACCESSION   XM_059366446
VERSION     XM_059366446.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 30% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1024
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1024
                     /gene="LOC131996700"
                     /note="uncharacterized LOC131996700; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996700"
     CDS             1..1020
                     /gene="LOC131996700"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996700"
                     /protein_id="XP_059222429.1"
                     /db_xref="GeneID:131996700"
                     /translation="MVIHNESLLLQTDMEFMIFLPSKNNNTNNKLSSTHTHTHICVAS
                     AAHSYVLNTTTRLSNVRAKLRKCLQSLWQHRPGLCYVSFLACYAKGFECCGICKIKRK
                     CSEEAVAFGISPLHARIKFMECILHISYRLSFKKWRTDSYTKIEMAANKAEIGKRLKL
                     TLGINVDAVKQGMGTTNDGNTARRFFENPAKTADVIGIKEELIHRFKIILAAINCNAA
                     VDTSKFHIYCMDTAKLFVDLYGWYYMPVTVHKILVHGSKIIAEAILPIGMLSEEAQEA
                     RNKDYRAYRLHHSRRIGRVATNEDVMHNLLLSSDPFINRFRSKLQIKKLEYDNDVKKL
                     LKDYA"
     polyA_site      1024
                     /gene="LOC131996700"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggtcattc ataacgaatc tttgctgctg cagacagaca tggagttcat gatatttttg
       61 cccagcaaaa acaacaacac caacaacaag ctctcatcca ctcatacgca cacacacata
      121 tgtgtggcct cagccgccca ctcgtatgtg ttaaacacga caacgaggct atccaatgtg
      181 cgtgcaaagc tgcgtaaatg tttgcagagc ttatggcagc ataggccagg gctatgctat
      241 gtctcctttc tcgcctgcta cgccaaagga tttgaatgtt gcggcatttg caagatcaag
      301 cggaaatgtt cggaagaagc agttgcgttt ggtatttctc ccttgcatgc gagaatcaaa
      361 tttatggagt gcattctgca catttcttac cgtctaagtt tcaaaaaatg gagaacagat
      421 agttacacaa aaattgaaat ggcggcaaat aaagctgaaa ttgggaagag attaaagttg
      481 acactgggca taaatgtgga cgcggtgaag caaggtatgg gcacaacaaa cgatggcaat
      541 acggcaagaa ggtttttcga aaatccagcc aaaactgcag acgtaattgg aataaaagaa
      601 gagttaatac atagatttaa aattattttg gccgcaataa attgtaatgc agcagtcgac
      661 actagcaaat ttcatatata ttgcatggat actgccaagt tgtttgttga tctctatggc
      721 tggtactaca tgcctgtaac tgtgcataag attctggtgc atggtagcaa aattatagca
      781 gaagctattc tgccaatagg tatgctgtcc gaagaagctc aggaagcgag gaataaagat
      841 tatagagcct atagattaca tcattcgcga agaattggac gtgtagccac taatgaagat
      901 gtaatgcata accttttatt gtcttcagac ccatttataa atagatttcg ctcaaagctg
      961 caaatcaaaa aattggagta cgataatgat gttaaaaaat tattaaaaga ctatgcttaa
     1021 ttta