Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-signal (LOC106080854), transcript


LOCUS       XM_059366442             768 bp    mRNA    linear   INV 02-SEP-2023
            variant X7, mRNA.
ACCESSION   XM_059366442
VERSION     XM_059366442.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..768
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..768
                     /gene="LOC106080854"
                     /note="C-signal; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106080854"
     CDS             39..719
                     /gene="LOC106080854"
                     /codon_start=1
                     /product="C-signal isoform X3"
                     /protein_id="XP_059222425.1"
                     /db_xref="GeneID:106080854"
                     /translation="MLRYVCLFNLNCIDSLLFKIKDLLNLAAQNSNIHVMEIDLRDYY
                     SHDNLVKQIDDITGGYGLNLLFNNAGISPKSTRINMTKAEDIMNTLETNTVVPIMLAK
                     ACLPLLKKASKSQESLDLCVQRAAIINMSSMLGSIEMNETGGLYAYRTSKAALNAATK
                     SLSIDLLPHNILCVALHPGWVRTEMGGKNAPLEVDPTTAEIIDTIMKFKAKHNGGFYQ
                     YNGDKLPW"
     polyA_site      768
                     /gene="LOC106080854"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtattttg tattgcgaac ttcttgtaga cgtatcacat gttgagatac gtttgtttat
       61 tcaatttaaa ttgcatagac tctttgcttt tcaagattaa ggaccttcta aatttggctg
      121 cccaaaattc caatattcat gtaatggaaa ttgatttgcg cgactattat tcccacgaca
      181 atttagttaa acaaatagat gacatcacag gtggctatgg tctcaatcta ctcttcaata
      241 atgccggaat ttctccaaaa tcgactagga taaatatgac taaggcagag gatataatga
      301 atacattaga aaccaacaca gttgtgccta ttatgttggc taaagcctgt ttaccattac
      361 ttaaaaaagc ctccaaatca caggaatctc tcgatttgtg tgtacagagg gctgctatta
      421 taaatatgag ctctatgttg ggatcaatcg aaatgaatga aactggtggc ctctatgcat
      481 atcggacttc caaagctgct ttaaatgctg caacaaaatc gctgagtatt gatttgttgc
      541 cgcataacat tctttgtgtt gccttacatc ccggctgggt gcgcacagaa atgggtggaa
      601 agaacgctcc attggaagtt gatcccacaa ctgcggaaat cattgatact atcatgaagt
      661 tcaaagcgaa gcataatgga ggtttctatc agtacaatgg tgacaaattg ccatggtagt
      721 taagactaag tgatataaat gaataaaatg aaattgcttg caactaaa