Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366442 768 bp mRNA linear INV 02-SEP-2023 variant X7, mRNA. ACCESSION XM_059366442 VERSION XM_059366442.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..768 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..768 /gene="LOC106080854" /note="C-signal; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106080854" CDS 39..719 /gene="LOC106080854" /codon_start=1 /product="C-signal isoform X3" /protein_id="XP_059222425.1" /db_xref="GeneID:106080854" /translation="MLRYVCLFNLNCIDSLLFKIKDLLNLAAQNSNIHVMEIDLRDYY SHDNLVKQIDDITGGYGLNLLFNNAGISPKSTRINMTKAEDIMNTLETNTVVPIMLAK ACLPLLKKASKSQESLDLCVQRAAIINMSSMLGSIEMNETGGLYAYRTSKAALNAATK SLSIDLLPHNILCVALHPGWVRTEMGGKNAPLEVDPTTAEIIDTIMKFKAKHNGGFYQ YNGDKLPW" polyA_site 768 /gene="LOC106080854" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtattttg tattgcgaac ttcttgtaga cgtatcacat gttgagatac gtttgtttat 61 tcaatttaaa ttgcatagac tctttgcttt tcaagattaa ggaccttcta aatttggctg 121 cccaaaattc caatattcat gtaatggaaa ttgatttgcg cgactattat tcccacgaca 181 atttagttaa acaaatagat gacatcacag gtggctatgg tctcaatcta ctcttcaata 241 atgccggaat ttctccaaaa tcgactagga taaatatgac taaggcagag gatataatga 301 atacattaga aaccaacaca gttgtgccta ttatgttggc taaagcctgt ttaccattac 361 ttaaaaaagc ctccaaatca caggaatctc tcgatttgtg tgtacagagg gctgctatta 421 taaatatgag ctctatgttg ggatcaatcg aaatgaatga aactggtggc ctctatgcat 481 atcggacttc caaagctgct ttaaatgctg caacaaaatc gctgagtatt gatttgttgc 541 cgcataacat tctttgtgtt gccttacatc ccggctgggt gcgcacagaa atgggtggaa 601 agaacgctcc attggaagtt gatcccacaa ctgcggaaat cattgatact atcatgaagt 661 tcaaagcgaa gcataatgga ggtttctatc agtacaatgg tgacaaattg ccatggtagt 721 taagactaag tgatataaat gaataaaatg aaattgcttg caactaaa