Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366432 1101 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059366432 VERSION XM_059366432.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1101 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1101 /gene="LOC131996694" /note="loricrin-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996694" CDS 1..1101 /gene="LOC131996694" /codon_start=1 /product="loricrin-like" /protein_id="XP_059222415.1" /db_xref="GeneID:131996694" /translation="MKQLGIFLTVSLAIAAYGFPIYEHYNSYNHHGHGGCSHSSGDAH LLNNFMGFVQNLMHSQNGGGGGGGYGCGGYGRKCGCGGYGGGSGMDCNCYGNENCDDG GGDGGGDDGGADDDVITPPTTTSTTTTSTTTTTTTTTTPAPTTTTTTRRTTTRRPRPT TCRPRPRPYYPPKPYYPPKSYNSYPSPPSYGPSNYGNSNGFGGNGNGFAASPSFGSSA TGGFGGASAPGGFGGGAAPVGFGRGSAPSYGAAPSYGSAPSYGGTPGYGGAAPSYKSP SNTGGISSIDLLASSAALAQASSSSAMRIPTATKDVIIVTNNLPGGSPTAVYPTQREG RKRVCFKTYCMDDDKYDKYDRYDFLDKIAQSY" ORIGIN 1 atgaaacaac tgggaatatt tctcaccgtg tcattggcca tagcggccta tggatttcca 61 atatatgaac attacaattc ttacaatcat catggacatg gtggctgctc acattcatcg 121 ggagatgccc atttgctgaa taattttatg ggctttgttc agaacctgat gcatagtcaa 181 aacggtggag gtggtggtgg aggatacggc tgtggtggat atggccgaaa gtgtggttgc 241 ggtggctatg ggggaggaag tggcatggat tgcaattgtt atggtaatga aaactgtgat 301 gatggtggtg gtgacggtgg aggcgatgac ggaggagcag atgatgacgt tatcacgcca 361 cccactacaa cttccacaac aactacatct acaacaacga ctacaacaac aaccacaaca 421 ccagctccca ctaccacaac aacgacccgt cgtaccacaa ctcgcagacc tcgacccaca 481 acctgcagac ccagaccaag gccttactat ccacccaagc cctattatcc gcccaagagc 541 tataattcat atcccagccc acccagctat ggaccatcca attatggcaa ctccaatggt 601 tttggtggaa atggaaatgg ctttgcagcc tctccaagtt ttggcagctc tgcaacaggt 661 ggttttggtg gagcttctgc tcccggaggt tttggtggag gtgctgctcc tgtaggtttt 721 ggtagaggtt ctgcacccag ctatggagct gcacccagct atggatctgc acctagttat 781 ggcggcaccc ctggttatgg tggtgctgca cccagctaca aaagcccttc taatacgggc 841 ggtatctcta gcattgatct tttggcttcc agcgccgctc tagcccaggc cagttcatcc 901 tctgccatgc gcatacccac cgccactaaa gatgtgataa ttgtaacgaa caatttgcct 961 ggaggatcac ccactgccgt atatcccact cagagggagg gaaggaaacg agtttgtttc 1021 aaaacctatt gcatggacga tgataagtac gacaaatacg atagatacga tttcctagat 1081 aaaattgcac agagttattg a