Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans loricrin-like (LOC131996694), mRNA.


LOCUS       XM_059366432            1101 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059366432
VERSION     XM_059366432.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1101
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1101
                     /gene="LOC131996694"
                     /note="loricrin-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:131996694"
     CDS             1..1101
                     /gene="LOC131996694"
                     /codon_start=1
                     /product="loricrin-like"
                     /protein_id="XP_059222415.1"
                     /db_xref="GeneID:131996694"
                     /translation="MKQLGIFLTVSLAIAAYGFPIYEHYNSYNHHGHGGCSHSSGDAH
                     LLNNFMGFVQNLMHSQNGGGGGGGYGCGGYGRKCGCGGYGGGSGMDCNCYGNENCDDG
                     GGDGGGDDGGADDDVITPPTTTSTTTTSTTTTTTTTTTPAPTTTTTTRRTTTRRPRPT
                     TCRPRPRPYYPPKPYYPPKSYNSYPSPPSYGPSNYGNSNGFGGNGNGFAASPSFGSSA
                     TGGFGGASAPGGFGGGAAPVGFGRGSAPSYGAAPSYGSAPSYGGTPGYGGAAPSYKSP
                     SNTGGISSIDLLASSAALAQASSSSAMRIPTATKDVIIVTNNLPGGSPTAVYPTQREG
                     RKRVCFKTYCMDDDKYDKYDRYDFLDKIAQSY"
ORIGIN      
        1 atgaaacaac tgggaatatt tctcaccgtg tcattggcca tagcggccta tggatttcca
       61 atatatgaac attacaattc ttacaatcat catggacatg gtggctgctc acattcatcg
      121 ggagatgccc atttgctgaa taattttatg ggctttgttc agaacctgat gcatagtcaa
      181 aacggtggag gtggtggtgg aggatacggc tgtggtggat atggccgaaa gtgtggttgc
      241 ggtggctatg ggggaggaag tggcatggat tgcaattgtt atggtaatga aaactgtgat
      301 gatggtggtg gtgacggtgg aggcgatgac ggaggagcag atgatgacgt tatcacgcca
      361 cccactacaa cttccacaac aactacatct acaacaacga ctacaacaac aaccacaaca
      421 ccagctccca ctaccacaac aacgacccgt cgtaccacaa ctcgcagacc tcgacccaca
      481 acctgcagac ccagaccaag gccttactat ccacccaagc cctattatcc gcccaagagc
      541 tataattcat atcccagccc acccagctat ggaccatcca attatggcaa ctccaatggt
      601 tttggtggaa atggaaatgg ctttgcagcc tctccaagtt ttggcagctc tgcaacaggt
      661 ggttttggtg gagcttctgc tcccggaggt tttggtggag gtgctgctcc tgtaggtttt
      721 ggtagaggtt ctgcacccag ctatggagct gcacccagct atggatctgc acctagttat
      781 ggcggcaccc ctggttatgg tggtgctgca cccagctaca aaagcccttc taatacgggc
      841 ggtatctcta gcattgatct tttggcttcc agcgccgctc tagcccaggc cagttcatcc
      901 tctgccatgc gcatacccac cgccactaaa gatgtgataa ttgtaacgaa caatttgcct
      961 ggaggatcac ccactgccgt atatcccact cagagggagg gaaggaaacg agtttgtttc
     1021 aaaacctatt gcatggacga tgataagtac gacaaatacg atagatacga tttcctagat
     1081 aaaattgcac agagttattg a