Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans B9 domain-containing protein 1


LOCUS       XM_059366430             691 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080755), mRNA.
ACCESSION   XM_059366430
VERSION     XM_059366430.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..691
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..691
                     /gene="LOC106080755"
                     /note="B9 domain-containing protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106080755"
     CDS             39..620
                     /gene="LOC106080755"
                     /codon_start=1
                     /product="B9 domain-containing protein 1"
                     /protein_id="XP_059222413.1"
                     /db_xref="GeneID:106080755"
                     /translation="METNTTAASYFNIFITGHLESANFPLGPEAKDIFCRYEAFAGPD
                     WELVSGTKNGITQLASNRNGNFNDPIVFNMPIELTYRSTNVFGWPQLIVCVYGRTRWG
                     IETSLGYSRLHVPVFGSGTNQRIVAPILKPRCSNAMADVTSWITGRNPELKDSKILLD
                     NTKTKGLSIESYGEIEFVLNVITRGSARLGLEY"
     polyA_site      691
                     /gene="LOC106080755"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatccacatt ttgtgttcag tttaaaaaaa agtcaacaat ggaaactaat acaacagcgg
       61 caagctattt taatatcttc ataactggac atttggagtc tgcaaatttt cctctgggac
      121 ccgaagccaa agacatattt tgtcgatatg aagcattcgc aggacctgac tgggaacttg
      181 taagcggcac gaagaatggc atcacacaat tggcatctaa tcgaaatggg aatttcaatg
      241 accccattgt atttaatatg cccatagagt tgacctatcg tagtacaaat gtttttggat
      301 ggccgcaact aatagtctgt gtttatgggc gcacacggtg gggaatagag acctcactgg
      361 gatatagccg tcttcatgtt ccagtttttg gtagtggaac taatcaacgt attgtagcgc
      421 ccatattgaa accacgctgc agtaatgcaa tggctgacgt tactagttgg ataactggac
      481 gaaatccgga gctaaaggat tcaaaaatat tgcttgataa caccaaaact aagggattat
      541 ctatagagtc gtatggagaa atcgaatttg tgctcaacgt tataaccaga ggttcggccc
      601 gtctaggttt agaatactaa taagctatgc acatttagtt tagtgaaaca attatgtttt
      661 atcgtttaat aaatttttta ttaatattat a