Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366430 691 bp mRNA linear INV 02-SEP-2023 (LOC106080755), mRNA. ACCESSION XM_059366430 VERSION XM_059366430.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..691 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..691 /gene="LOC106080755" /note="B9 domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106080755" CDS 39..620 /gene="LOC106080755" /codon_start=1 /product="B9 domain-containing protein 1" /protein_id="XP_059222413.1" /db_xref="GeneID:106080755" /translation="METNTTAASYFNIFITGHLESANFPLGPEAKDIFCRYEAFAGPD WELVSGTKNGITQLASNRNGNFNDPIVFNMPIELTYRSTNVFGWPQLIVCVYGRTRWG IETSLGYSRLHVPVFGSGTNQRIVAPILKPRCSNAMADVTSWITGRNPELKDSKILLD NTKTKGLSIESYGEIEFVLNVITRGSARLGLEY" polyA_site 691 /gene="LOC106080755" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatccacatt ttgtgttcag tttaaaaaaa agtcaacaat ggaaactaat acaacagcgg 61 caagctattt taatatcttc ataactggac atttggagtc tgcaaatttt cctctgggac 121 ccgaagccaa agacatattt tgtcgatatg aagcattcgc aggacctgac tgggaacttg 181 taagcggcac gaagaatggc atcacacaat tggcatctaa tcgaaatggg aatttcaatg 241 accccattgt atttaatatg cccatagagt tgacctatcg tagtacaaat gtttttggat 301 ggccgcaact aatagtctgt gtttatgggc gcacacggtg gggaatagag acctcactgg 361 gatatagccg tcttcatgtt ccagtttttg gtagtggaac taatcaacgt attgtagcgc 421 ccatattgaa accacgctgc agtaatgcaa tggctgacgt tactagttgg ataactggac 481 gaaatccgga gctaaaggat tcaaaaatat tgcttgataa caccaaaact aagggattat 541 ctatagagtc gtatggagaa atcgaatttg tgctcaacgt tataaccaga ggttcggccc 601 gtctaggttt agaatactaa taagctatgc acatttagtt tagtgaaaca attatgtttt 661 atcgtttaat aaatttttta ttaatattat a