Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366420 1077 bp mRNA linear INV 02-SEP-2023 (LOC131996692), mRNA. ACCESSION XM_059366420 VERSION XM_059366420.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1077 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1077 /gene="LOC131996692" /note="uncharacterized LOC131996692; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996692" CDS 212..808 /gene="LOC131996692" /codon_start=1 /product="uncharacterized protein LOC131996692" /protein_id="XP_059222403.1" /db_xref="GeneID:131996692" /translation="MGLLGRRTLSKYGFRGIFYCSTGFNRMPAGCTFRIDPFESMEWA MYCHCDVQSSGQGVPSSSSWVSRVEYAFAICCVCSFSIFSSRAVSDRTFLPILKRVRT FAVTSVINLVSRVFCRVTAMWLCDFFKLKSGAANYHVFCRGESYQPQTTIGRYLVEAK FSDCWTKMSSFPLLALISPRTVLVSWAGQRSYFLSRRS" ORIGIN 1 gtgctgcacc aaagcaatcg gtatgagttc cggtctacat tctggctctt gtacatatca 61 attcgtccac attcaagtct ttccatttcc tttttctttc tgcggaataa acgtttctcc 121 tctctccatt tctcccaata ccactccgtc agagttgctc tgtatgccgc atacttggct 181 tcagtagcat cttgacactc ttggtcgtac catgggttta ttggggaggc gtacgttatc 241 caagtacgga tttcgcggca tcttttattg cagtacaggc ttcaatcgca tgccagccgg 301 ttgtacgttc cggattgacc cgtttgaatc catggagtgg gcaatgtatt gccactgcga 361 cgttcaatca tcgggacaag gagtgccttc atcaagcagt tgggttagtc gagtggagta 421 tgcctttgcc atctgttgtg tttgcagctt ttcaattttc agctctcgtg cagtgtcaga 481 tcgtactttt ctccccatac tcaaacgggt gcgaaccttt gcagtaacaa gcgtgatcaa 541 tttggtttct cgtgtctttt gtcgagtgac agcaatgtgg ctttgtgatt tttttaagtt 601 gaaatctggt gctgcaaact accatgtttt ttgccgcggc gaaagctatc aacctcaaac 661 cactattgga cgttatctcg tggaggctaa attttctgac tgttggacca agatgtcttc 721 tttccctctc ttagcattaa tatctcccag aacggttttg gtttcatggg ctgggcagcg 781 gtcgtatttt ctctctaggc gctcgtagaa aatatccttg gtctgctcgc ccttgtcttt 841 cgttgctaaa atttagcaca ggtattggta cgtcaaattc ttttatgcaa aattttgaga 901 aaattggacc aaaagtgata cctgtcttaa acggcatatc ggatgaaagg tatacatgag 961 agctaaatcc gatccgactt ggaggaaatt tatcacacgc attgggacgt ttaataaaat 1021 acctcaacct aaattgtgta caaattggaa cgaaattgag gcttatacag ccttaaa