Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996692


LOCUS       XM_059366420            1077 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996692), mRNA.
ACCESSION   XM_059366420
VERSION     XM_059366420.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1077
                     /gene="LOC131996692"
                     /note="uncharacterized LOC131996692; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996692"
     CDS             212..808
                     /gene="LOC131996692"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996692"
                     /protein_id="XP_059222403.1"
                     /db_xref="GeneID:131996692"
                     /translation="MGLLGRRTLSKYGFRGIFYCSTGFNRMPAGCTFRIDPFESMEWA
                     MYCHCDVQSSGQGVPSSSSWVSRVEYAFAICCVCSFSIFSSRAVSDRTFLPILKRVRT
                     FAVTSVINLVSRVFCRVTAMWLCDFFKLKSGAANYHVFCRGESYQPQTTIGRYLVEAK
                     FSDCWTKMSSFPLLALISPRTVLVSWAGQRSYFLSRRS"
ORIGIN      
        1 gtgctgcacc aaagcaatcg gtatgagttc cggtctacat tctggctctt gtacatatca
       61 attcgtccac attcaagtct ttccatttcc tttttctttc tgcggaataa acgtttctcc
      121 tctctccatt tctcccaata ccactccgtc agagttgctc tgtatgccgc atacttggct
      181 tcagtagcat cttgacactc ttggtcgtac catgggttta ttggggaggc gtacgttatc
      241 caagtacgga tttcgcggca tcttttattg cagtacaggc ttcaatcgca tgccagccgg
      301 ttgtacgttc cggattgacc cgtttgaatc catggagtgg gcaatgtatt gccactgcga
      361 cgttcaatca tcgggacaag gagtgccttc atcaagcagt tgggttagtc gagtggagta
      421 tgcctttgcc atctgttgtg tttgcagctt ttcaattttc agctctcgtg cagtgtcaga
      481 tcgtactttt ctccccatac tcaaacgggt gcgaaccttt gcagtaacaa gcgtgatcaa
      541 tttggtttct cgtgtctttt gtcgagtgac agcaatgtgg ctttgtgatt tttttaagtt
      601 gaaatctggt gctgcaaact accatgtttt ttgccgcggc gaaagctatc aacctcaaac
      661 cactattgga cgttatctcg tggaggctaa attttctgac tgttggacca agatgtcttc
      721 tttccctctc ttagcattaa tatctcccag aacggttttg gtttcatggg ctgggcagcg
      781 gtcgtatttt ctctctaggc gctcgtagaa aatatccttg gtctgctcgc ccttgtcttt
      841 cgttgctaaa atttagcaca ggtattggta cgtcaaattc ttttatgcaa aattttgaga
      901 aaattggacc aaaagtgata cctgtcttaa acggcatatc ggatgaaagg tatacatgag
      961 agctaaatcc gatccgactt ggaggaaatt tatcacacgc attgggacgt ttaataaaat
     1021 acctcaacct aaattgtgta caaattggaa cgaaattgag gcttatacag ccttaaa