Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans myb/SANT-like DNA-binding


LOCUS       XM_059366415            1081 bp    mRNA    linear   INV 02-SEP-2023
            domain-containing protein 1 (LOC131996690), mRNA.
ACCESSION   XM_059366415
VERSION     XM_059366415.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1081
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1081
                     /gene="LOC131996690"
                     /note="myb/SANT-like DNA-binding domain-containing protein
                     1; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:131996690"
     CDS             446..847
                     /gene="LOC131996690"
                     /codon_start=1
                     /product="myb/SANT-like DNA-binding domain-containing
                     protein 1"
                     /protein_id="XP_059222398.1"
                     /db_xref="GeneID:131996690"
                     /translation="MEKDGSAKQTRKRWSVEGEHFLLTLWVKHLEELREARKNAHVYI
                     NMAAAMSAKGYFYSREEIKTKLHNLTSKYRFFSSYRDEIKKSDQTGQPPSWDLFEKIN
                     KILGEYKYHKASSFEEQSFGMCTNIKTYGIS"
ORIGIN      
        1 ctcaaaggca ttccaaacaa tttggatttg ttcgagtttt acttaaaacg agatcattta
       61 ttttgctctt gtaaacgtga attagcaaac accatcagcc ttccaattat attatccttt
      121 aaatcaatct aaaagtaagg gatttatacg tgattttact taaaacacga taatttattt
      181 tgccatgtaa acagtttttt tattgattta ccttcgtcac acacatatac acaaaatttg
      241 cttcgttttc tatattcagt acaaactcaa agctgtgtgt gtgtgtttta ttgcaagttt
      301 tataaataaa tcaactttgt attattgtgt cgttaaacgt acaaacaaaa cccgttttaa
      361 gccaacgaaa attaatatac ataattgata gcaggcaaaa aacgttttca actaaccaag
      421 tatagatcag aaaatttcaa ataaaatgga aaaagatggt tcagcaaaac aaactcgcaa
      481 acgttggtcg gtcgaaggcg aacacttttt gcttacctta tgggtgaaac atctggagga
      541 attgcgagaa gctcggaaaa atgcacatgt atatatcaat atggccgcag caatgtccgc
      601 caaaggatat ttttactcga gggaagaaat taaaaccaaa ttacacaacc ttaccagtaa
      661 atatagattt ttttcttctt acagggatga aataaagaaa tctgaccaaa caggacaacc
      721 gcccagctgg gatttattcg aaaagatcaa caaaatttta ggagaataca aatatcataa
      781 ggcgtcgtct ttcgaagagc aaagctttgg tatgtgtaca aacataaaaa cctatggcat
      841 atcataacgt atatatatta cattattgct tccaatattt attttgcaat ggcgcttttt
      901 ttattttatt cggtttgaat ttcttgtttc tgttttgcaa tcgcagcgca tggatcttta
      961 ttatttgaac cgtgtgctct tacaatatga cgataaagtc cacggtagtg cgcgtaatcc
     1021 ttaccacaag ccttgcattc aaacttctgt ccattatgga catttttgtg ttgattcaat
     1081 a