Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366415 1081 bp mRNA linear INV 02-SEP-2023 domain-containing protein 1 (LOC131996690), mRNA. ACCESSION XM_059366415 VERSION XM_059366415.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1081 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1081 /gene="LOC131996690" /note="myb/SANT-like DNA-binding domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996690" CDS 446..847 /gene="LOC131996690" /codon_start=1 /product="myb/SANT-like DNA-binding domain-containing protein 1" /protein_id="XP_059222398.1" /db_xref="GeneID:131996690" /translation="MEKDGSAKQTRKRWSVEGEHFLLTLWVKHLEELREARKNAHVYI NMAAAMSAKGYFYSREEIKTKLHNLTSKYRFFSSYRDEIKKSDQTGQPPSWDLFEKIN KILGEYKYHKASSFEEQSFGMCTNIKTYGIS" ORIGIN 1 ctcaaaggca ttccaaacaa tttggatttg ttcgagtttt acttaaaacg agatcattta 61 ttttgctctt gtaaacgtga attagcaaac accatcagcc ttccaattat attatccttt 121 aaatcaatct aaaagtaagg gatttatacg tgattttact taaaacacga taatttattt 181 tgccatgtaa acagtttttt tattgattta ccttcgtcac acacatatac acaaaatttg 241 cttcgttttc tatattcagt acaaactcaa agctgtgtgt gtgtgtttta ttgcaagttt 301 tataaataaa tcaactttgt attattgtgt cgttaaacgt acaaacaaaa cccgttttaa 361 gccaacgaaa attaatatac ataattgata gcaggcaaaa aacgttttca actaaccaag 421 tatagatcag aaaatttcaa ataaaatgga aaaagatggt tcagcaaaac aaactcgcaa 481 acgttggtcg gtcgaaggcg aacacttttt gcttacctta tgggtgaaac atctggagga 541 attgcgagaa gctcggaaaa atgcacatgt atatatcaat atggccgcag caatgtccgc 601 caaaggatat ttttactcga gggaagaaat taaaaccaaa ttacacaacc ttaccagtaa 661 atatagattt ttttcttctt acagggatga aataaagaaa tctgaccaaa caggacaacc 721 gcccagctgg gatttattcg aaaagatcaa caaaatttta ggagaataca aatatcataa 781 ggcgtcgtct ttcgaagagc aaagctttgg tatgtgtaca aacataaaaa cctatggcat 841 atcataacgt atatatatta cattattgct tccaatattt attttgcaat ggcgcttttt 901 ttattttatt cggtttgaat ttcttgtttc tgttttgcaa tcgcagcgca tggatcttta 961 ttatttgaac cgtgtgctct tacaatatga cgataaagtc cacggtagtg cgcgtaatcc 1021 ttaccacaag ccttgcattc aaacttctgt ccattatgga catttttgtg ttgattcaat 1081 a