Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans general odorant-binding protein


LOCUS       XM_059366365             464 bp    mRNA    linear   INV 02-SEP-2023
            19a-like (LOC131996684), mRNA.
ACCESSION   XM_059366365
VERSION     XM_059366365.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..464
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..464
                     /gene="LOC131996684"
                     /note="general odorant-binding protein 19a-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:131996684"
     CDS             42..356
                     /gene="LOC131996684"
                     /codon_start=1
                     /product="general odorant-binding protein 19a-like"
                     /protein_id="XP_059222348.1"
                     /db_xref="GeneID:131996684"
                     /translation="MEIKNFIKKERGNRGPGVNGLKISEKNATEEQMWAADGLMRDVC
                     LPKFLKITNETGAGIRAGTLSNDKDAKCNINYAMEMMQTVRSSKEQMKKSKKKTTQER
                     LR"
ORIGIN      
        1 tacgtaaaaa aatttctgcg tcaatataaa ttcttaaaat aatggaaata aaaaatttca
       61 ttaaaaaaga acgaggaaat cgagggccag gcgttaatgg gttaaaaatc tcagagaaaa
      121 acgcaaccga agaacaaatg tgggctgccg atggacttat gagagatgtg tgcctaccaa
      181 aattcctcaa aataactaac gaaactggtg ctggaatcag agctggtacc ctatctaatg
      241 ataaggatgc caaatgcaat ataaactacg ctatggaaat gatgcaaacg gtaagaagta
      301 gtaaagaaca aatgaaaaag tctaaaaaga agacaactca ggaaagattg agatgatttt
      361 aatgttaaaa tttttttatt tcattccttt tcaccataga tgaagaaggg aagttcttgt
      421 atgaagcttc tttgaagcaa gtcgatatcc tcatgcccga tgac