Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366365 464 bp mRNA linear INV 02-SEP-2023 19a-like (LOC131996684), mRNA. ACCESSION XM_059366365 VERSION XM_059366365.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..464 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..464 /gene="LOC131996684" /note="general odorant-binding protein 19a-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996684" CDS 42..356 /gene="LOC131996684" /codon_start=1 /product="general odorant-binding protein 19a-like" /protein_id="XP_059222348.1" /db_xref="GeneID:131996684" /translation="MEIKNFIKKERGNRGPGVNGLKISEKNATEEQMWAADGLMRDVC LPKFLKITNETGAGIRAGTLSNDKDAKCNINYAMEMMQTVRSSKEQMKKSKKKTTQER LR" ORIGIN 1 tacgtaaaaa aatttctgcg tcaatataaa ttcttaaaat aatggaaata aaaaatttca 61 ttaaaaaaga acgaggaaat cgagggccag gcgttaatgg gttaaaaatc tcagagaaaa 121 acgcaaccga agaacaaatg tgggctgccg atggacttat gagagatgtg tgcctaccaa 181 aattcctcaa aataactaac gaaactggtg ctggaatcag agctggtacc ctatctaatg 241 ataaggatgc caaatgcaat ataaactacg ctatggaaat gatgcaaacg gtaagaagta 301 gtaaagaaca aatgaaaaag tctaaaaaga agacaactca ggaaagattg agatgatttt 361 aatgttaaaa tttttttatt tcattccttt tcaccataga tgaagaaggg aagttcttgt 421 atgaagcttc tttgaagcaa gtcgatatcc tcatgcccga tgac